KEGG   Felis catus (domestic cat): 101093276Help
Entry
101093276         CDS       T02385                                 

Gene name
EIF3J
Definition
eukaryotic translation initiation factor 3, subunit J
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101093276 (EIF3J)
Translation factors [BR:fca03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    101093276 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B3
AA seq 256 aa AA seqDB search
MAAAAAGDSDSWDADTFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEE
AEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKK
LQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEA
LVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLAD
YGGYDGGYVQDYEDFM
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagcagcgggggactctgactcctgggacgctgacacgttctccgtggaa
gacccggtgcggaaggtggggggcggcggcaccgccggcggggaccgctgggaaggcgag
gacgaggacgaggacgtcaaggataactgggatgatgatgatgatgaaaaaaaagaggaa
gcagaagtaaaaccagaagtaaaaatttcagaaaagaaaaaaatagcagagaaaataaaa
gagaaagaacggcagcagaaaaaaaggcaagaagaaattaaaaagaggttagaagaacct
gaagaacctaaagtgctaacaccagaagaacaattagcagataaactgcggctaaagaaa
ttacaggaagagtcagaccttgaattagcaaaagaaacttttggtgttaataatacagtt
tatggaatagatgctatgaacccatcttcaagagatgacttcacagagtttggaaagtta
ctaaaagataaaattacacaatatgaaaagtcactatattatgccagttttttggaagcc
ttagttcgagatgtgtgtatttcattggaaattgatgacttgaaaaagattaccaattca
ttgactgtgctttgcagtgaaaaacaaaagcaagaaaagcaaagcaaagccaaaaagaag
aagaaaggcgtggttcctggagggggattaaaggccaccatgaaagacgatctggcagat
tatggtggttatgatggaggatatgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system