KEGG   Felis catus (domestic cat): 101093298Help
Entry
101093298         CDS       T02385                                 

Gene name
STAMBPL1
Definition
STAM binding protein-like 1
Orthology
K11867  
AMSH-like protease [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101093298 (STAMBPL1)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M67
   101093298 (STAMBPL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D2
AA seq 436 aa AA seqDB search
MDQPFTVNSLRKLAAMPDHTDVSLSPEERVRALSKLGCNITITEDITPRRYFRSGVEMER
MASVYMEEGNLENAFVLYNKFITLFVEKLPSHRDYQQCAVPEKQDIMKKLKEIAFPRTDE
LKKDLLKKYNVEYQEYLQSKNKYDAEILKRLEHQSLIEAERKRVARMRQQQLESEQFLFF
EDQLKKQELARGQMRSPEPPALSEQIDGSAASCLCPRHSPSLLHVSADQPGKSDAANSAS
HSPPVNRALKPAATLSAVQNLVVEGLRCVVLSRDLCHKFLLLAESNTVRGVETCGILCGK
LTHNEFTITHVIVPKQSAGPDYCDVENVEELFSVQDQHGLLTLGWIHTHPTQTAFLSSVD
LHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACRKKGFHPHTKDPRLFSIC
KHVLVKDIKITMLDLR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggatcagccatttactgtgaattctctgagaaagctagctgctatgcctgaccacacg
gatgtttccctcagcccggaagagcgagtccgtgccctgagcaagcttggttgtaatatc
accatcacggaggacatcaccccacgccgctactttagatccggagtagagatggaaagg
atggcttcggtatatatggaagaaggaaatttggaaaatgcctttgtcctttataataaa
tttataacgttgtttgtggaaaagcttcccagccatcgagattaccagcagtgtgcggta
cctgaaaaacaggatattatgaagaaactgaaggagattgcattcccaaggacagatgaa
ttgaaaaaggaccttttaaagaaatataacgtagaataccaagaatatttgcaaagcaaa
aacaagtacgacgccgagattctcaaacgactggagcatcagagcctgatcgaggccgag
aggaagcgggtggctcggatgcgccagcagcagctggagtcggagcagttcctgtttttc
gaagaccagctcaagaagcaggaactggcccgcgggcagatgcgcagcccggagcccccc
gcgctgtccgagcagatcgacggcagcgccgcgtcctgcctgtgcccgcgccacagccct
tccctgctgcacgtctccgcggaccagcctggcaaaagcgacgcagccaattccgccagc
cactcgccccccgtcaacagggctctgaagcctgcggccactctgagcgccgtgcagaat
ttagtggttgaaggactgcgctgtgtagttttatccagagacctctgccacaaatttctg
ctgctggcagaatctaatacagtgagaggagtagaaacgtgtggaattctctgtggaaaa
ctgacgcataatgaatttactatcacccacgtgattgtgccaaagcagtctgccgggccg
gactactgtgacgtggagaatgtagaagaattattcagtgttcaggaccaacacggcctc
ctcacgctcggatggatccacacacatccgacccaaactgcgttcttgtccagtgttgac
cttcacactcactgttcctaccagctcatgttgccagaggccatcgccattgtttgctca
ccgaagcataaagacacgggcatcttcaggctgaccaacgccggcatgctcgaggtttct
gcctgtagaaagaagggctttcatccacacaccaaggaccccaggctgttcagtatatgc
aaacatgtgttggtaaaagacataaaaataaccatgctggatctaaggtga

DBGET integrated database retrieval system