KEGG   Felis catus (domestic cat): 101093307Help
Entry
101093307         CDS       T02385                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
fca  Felis catus (domestic cat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101093307 (GBA2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101093307 (GBA2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101093307 (GBA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 1016 aa AA seqDB search
MAAPESDLKGNKGGQRTQREDRGGARGGFIAVAANAAAATAPRLHGNTSSPRLSPAPGPP
RRHLTTTAARIWTCLERYFVPKDLGPGTIEAVGTQDPENMGTGVPASEQTSCAKGDPQVY
CPDNAGGTETGQVTDCDSPEDNRPLSEPGCSNPQDCGQLMASYEGKAKGYQVPPFGWRIC
LAHEFAEKRKPFNANNISLSNLIKHLGMGLRYLQWWYRKTQVEKKTPFIDLINCVPLRQI
YGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVVADQFTVCLRREGTTVYQQVLSVE
RPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLTCRQITPILPHDYQDSSLPVG
VFVWDVENEGDEALDVSIMFSMRNGLGGGDDAPGGLWNEPFCLERDGETVQGLLLHHPTL
PNPYTMAVAARLTADTTVTHITAFDPDSTGQQVWQDLLQDGQLDSPAGRSTPSQKGVGIA
GAVCVTGKLPPRGQCRLEFSLAWDMPRIMFGAKGQVYYRRYTRFFGRDGNAAPTLSHYAL
CRYTDWEEKISAWQSPVLDDRSLPAWYKSALFNELYFLADGGTVWLEVPEDSLPEELVGS
MCQLRPILQEYGRFGYLEGQEYRMYNTYDVHFYASFALVMLWPKLELSLQYDMALATLRE
DLTRRQYLMSGVMAPVKRRNVIPHDIGDPDDEPWLRVNAYVVHDTADWKDLNLKFVLQVY
RDYYLTGDQGFLRDMWPVCLAVMESEMKFDKDQDGLIENGGYADQTYDGWVTTGPSAYCG
GLWLAAVAVMVQMAVLCGAQDVQDKFSSILRRGQEAYERLLWNGRYYNYDCSPPPQSCSI
MSDQCAGQWFLRASGLGEGDTEVFPTPHVVCALQTIFEFNVRAFAGGAMGAVNGMQPHGV
PDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGCYRTVWERLGLAFQTPEAYCQQ
RVFRSLAYMRPLSIWAMQLALQQQQHKKASRPIAEQGTGLSTGPKLGPKEAMANPK
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccggaatcagatctaaaaggaaacaaggggggtcagaggacccagagagaa
gaccgagggggagcccgaggcggctttattgctgtcgccgccaacgccgctgcagcaaca
gctcccaggctccacggaaacactagctcacctcggctttccccagcgcctggccctccg
agacgacacctaacaaccaccgccgcccgcatctggacttgcctagagagatactttgta
cccaaagacttgggacccgggaccatcgaggccgtggggacccaggatcctgagaacatg
ggaaccggagtcccagcctcggagcagactagctgtgccaaaggggatccacaggtttat
tgccctgataatgctggaggcactgagactgggcaggttacagactgcgacagccctgaa
gacaatcggcccctaagtgagccgggctgcagcaatccgcaggactgtgggcaactgatg
gcttcttatgaaggcaaagctaagggctaccaggtgcctccctttggctggcgcatctgc
ctggctcatgagtttgcagagaagaggaaaccctttaatgccaacaacatctccctgagc
aacctgataaagcatctgggcatgggcttgcggtatttgcagtggtggtaccggaagacc
caggtggagaagaaaacacctttcattgacctcatcaattgtgtacccctgagacagatc
tatggttgtcctttgggtggcatcgggggaggcactatcactcgaggttggagaggccag
ttctgtcgttggcagctcaatcctggaatgtaccagcaccagacagtcgttgctgaccaa
ttcacagtgtgcttgcgtcgggaagggacgactgtgtaccagcaagtcctgtctgtggag
cgcccaagtgtcctacgcagctggaactggggcctgtgtgggtactttgcattctaccac
gccctctatccccgagcctggactgtctatcagcttcctggccagaatgtcacccttacc
tgtcgccagatcacacccatcttgccccatgactaccaggacagcagcctgcctgtagga
gtctttgtgtgggatgtggaaaatgaaggggatgaagccctggacgtgtccatcatgttc
tccatgcggaatggactggggggtggagatgatgccccagggggattgtggaatgagccc
ttctgtctggagcgtgatggggagactgtacaggggctgctgctgcatcatccaaccctt
ccaaacccctacacgatggctgtggctgcacgactcacggcggataccacggtaacccac
atcacagcctttgaccctgacagcactgggcagcaggtgtggcaagacctacttcaagat
ggacagctggactcccctgctggccgaagcaccccctcacagaaaggagtaggcattgct
ggggctgtgtgtgttacgggcaagctgccacctcgaggccagtgccgcctggagttctcg
ctggcttgggatatgcccagaatcatgtttggagctaagggccaggtctactacagacgg
tacacaaggttctttggccgcgatggtaatgcagctcccacccttagccactatgcattg
tgccgatacacagactgggaagagaagatctcagcttggcagagcccggtattggacgac
agatccttgcctgcctggtacaaatctgcgctgttcaatgaactatacttcctggctgat
ggaggcacagtatggctggaggttcctgaagactccttaccagaggagctggtgggaagc
atgtgtcagctccgccccatcctccaggagtatggtcgatttggctacctagaaggccag
gaatatcgcatgtacaacacatatgatgtccacttttatgcttcgttcgccctcgtcatg
ctctggcccaaactcgagctcagcctgcagtatgacatggctctggccacgctcagggag
gacctgacacggcgacaatacctgatgagtggggtaatggcacctgtgaaaaggaggaac
gtcatcccccatgatattggggacccagatgacgagccatggctccgggtcaatgcatat
gtggtccacgataccgctgactggaaggacctaaacctgaagtttgtgctgcaggtttac
cgagactattacctgacgggtgaccagggcttcctgagagacatgtggcctgtatgtctg
gccgtgatggagtctgaaatgaagtttgacaaggaccaagatggactcattgagaatgga
ggctatgcagaccagacctatgatggatgggtcaccacaggccccagtgcttactgtgga
ggactgtggctggcagctgtggctgtgatggttcagatggctgtcctatgtggggcacag
gatgtccaggataagttttcttccatccttagacgaggtcaagaagcctatgagagacta
ctatggaatggccgctattacaactatgattgcagccctccacctcagtcctgtagcatc
atgtctgaccagtgtgctggccagtggttcctgagggccagtggtctaggagaaggagac
actgaggtatttcctacccctcacgtggtctgtgctctccaaaccatcttcgagttcaat
gtccgggcctttgcaggaggagccatgggggctgtgaatgggatgcagccccatggtgtt
cctgacagatccagtgtccagtctgatgaagtctgggtgggtgtggtctatgggttggca
gccaccatgatccaggagggcctgacttgggaaggtttccagacagctgaaggctgctac
cgaactgtgtgggagcgcctgggcttggccttccagacccctgaagcatactgccagcag
cgggtattccgctcactggcctacatgcggccgctgagcatctgggccatgcagctggcc
ctgcagcagcagcagcataaaaaggcctccaggccgatagccgaacagggcacaggacta
agcacagggcctaaacttggaccaaaggaagccatggcaaacccaaagtga

DBGET integrated database retrieval system