KEGG   Felis catus (domestic cat): 101093307Help
Entry
101093307         CDS       T02385                                 

Gene name
GBA2
Definition
glucosidase, beta (bile acid) 2
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
fca  Felis catus (domestic cat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fca00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fca00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 917 aa AA seqDB search
MGTGVPASEQTSCAKGDPQVYCPDNAGGTETGQVTDCDSPEDNRPLSEPGCSNPQDCGQL
MASYEGKAKGYQVPPFGWRICLAHEFAEKRKPFNANNISLSNLIKHLGMGLRYLQWWYRK
TQVEKKTPFIDLINCVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVVAD
QFTVCLRREGTTVYQQVLSVERPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTL
TCRQITPILPHDYQDSSLPVGVFVWDVENEGDEALDVSIMFSMRNGLGGGDDAPGGLWNE
PFCLERDGETVQGLLLHHPTLPNPYTMAVAARLTADTTVTHITAFDPDSTGQQVWQDLLQ
DGQLDSPAGRSTPSQKGVGIAGAVCVTGKLPPRGQCRLEFSLAWDMPRIMFGAKGQVYYR
RYTRFFGRDGNAAPTLSHYALCRYTDWEEKISAWQSPVLDDRSLPAWYKSALFNELYFLA
DGGTVWLEVPEDSLPEELVGSMCQLRPILQEYGRFGYLEGQEYRMYNTYDVHFYASFALV
MLWPKLELSLQYDMALATLREDLTRRQYLMSGVMAPVKRRNVIPHDIGDPDDEPWLRVNA
YVVHDTADWKDLNLKFVLQVYRDYYLTGDQGFLRDMWPVCLAVMESEMKFDKDQDGLIEN
GGYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQDKFSSILRRGQEAYER
LLWNGRYYNYDCSPPPQSCSIMSDQCAGQWFLRASGLGEGDTEVFPTPHVVCALQTIFEF
NVRAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFQTAEGC
YRTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKASRPIAEQGTG
LSTGPKLGPKEAMANPK
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccggagtcccagcctcggagcagactagctgtgccaaaggggatccacaggtt
tattgccctgataatgctggaggcactgagactgggcaggttacagactgcgacagccct
gaagacaatcggcccctaagtgagccgggctgcagcaatccgcaggactgtgggcaactg
atggcttcttatgaaggcaaagctaagggctaccaggtgcctccctttggctggcgcatc
tgcctggctcatgagtttgcagagaagaggaaaccctttaatgccaacaacatctccctg
agcaacctgataaagcatctgggcatgggcttgcggtatttgcagtggtggtaccggaag
acccaggtggagaagaaaacacctttcattgacctcatcaattgtgtacccctgagacag
atctatggttgtcctttgggtggcatcgggggaggcactatcactcgaggttggagaggc
cagttctgtcgttggcagctcaatcctggaatgtaccagcaccagacagtcgttgctgac
caattcacagtgtgcttgcgtcgggaagggacgactgtgtaccagcaagtcctgtctgtg
gagcgcccaagtgtcctacgcagctggaactggggcctgtgtgggtactttgcattctac
cacgccctctatccccgagcctggactgtctatcagcttcctggccagaatgtcaccctt
acctgtcgccagatcacacccatcttgccccatgactaccaggacagcagcctgcctgta
ggagtctttgtgtgggatgtggaaaatgaaggggatgaagccctggacgtgtccatcatg
ttctccatgcggaatggactggggggtggagatgatgccccagggggattgtggaatgag
cccttctgtctggagcgtgatggggagactgtacaggggctgctgctgcatcatccaacc
cttccaaacccctacacgatggctgtggctgcacgactcacggcggataccacggtaacc
cacatcacagcctttgaccctgacagcactgggcagcaggtgtggcaagacctacttcaa
gatggacagctggactcccctgctggccgaagcaccccctcacagaaaggagtaggcatt
gctggggctgtgtgtgttacgggcaagctgccacctcgaggccagtgccgcctggagttc
tcgctggcttgggatatgcccagaatcatgtttggagctaagggccaggtctactacaga
cggtacacaaggttctttggccgcgatggtaatgcagctcccacccttagccactatgca
ttgtgccgatacacagactgggaagagaagatctcagcttggcagagcccggtattggac
gacagatccttgcctgcctggtacaaatctgcgctgttcaatgaactatacttcctggct
gatggaggcacagtatggctggaggttcctgaagactccttaccagaggagctggtggga
agcatgtgtcagctccgccccatcctccaggagtatggtcgatttggctacctagaaggc
caggaatatcgcatgtacaacacatatgatgtccacttttatgcttcgttcgccctcgtc
atgctctggcccaaactcgagctcagcctgcagtatgacatggctctggccacgctcagg
gaggacctgacacggcgacaatacctgatgagtggggtaatggcacctgtgaaaaggagg
aacgtcatcccccatgatattggggacccagatgacgagccatggctccgggtcaatgca
tatgtggtccacgataccgctgactggaaggacctaaacctgaagtttgtgctgcaggtt
taccgagactattacctgacgggtgaccagggcttcctgagagacatgtggcctgtatgt
ctggccgtgatggagtctgaaatgaagtttgacaaggaccaagatggactcattgagaat
ggaggctatgcagaccagacctatgatggatgggtcaccacaggccccagtgcttactgt
ggaggactgtggctggcagctgtggctgtgatggttcagatggctgtcctatgtggggca
caggatgtccaggataagttttcttccatccttagacgaggtcaagaagcctatgagaga
ctactatggaatggccgctattacaactatgattgcagccctccacctcagtcctgtagc
atcatgtctgaccagtgtgctggccagtggttcctgagggccagtggtctaggagaagga
gacactgaggtatttcctacccctcacgtggtctgtgctctccaaaccatcttcgagttc
aatgtccgggcctttgcaggaggagccatgggggctgtgaatgggatgcagccccatggt
gttcctgacagatccagtgtccagtctgatgaagtctgggtgggtgtggtctatgggttg
gcagccaccatgatccaggagggcctgacttgggaaggtttccagacagctgaaggctgc
taccgaactgtgtgggagcgcctgggcttggccttccagacccctgaagcatactgccag
cagcgggtattccgctcactggcctacatgcggccgctgagcatctgggccatgcagctg
gccctgcagcagcagcagcataaaaaggcctccaggccgatagccgaacagggcacagga
ctaagcacagggcctaaacttggaccaaaggaagccatggcaaacccaaagtga

DBGET integrated database retrieval system