KEGG   Felis catus (domestic cat): 101093415Help
Entry
101093415         CDS       T02385                                 

Gene name
XRCC4
Definition
X-ray repair complementing defective repair in Chinese hamster cells 4
Orthology
K10886  
DNA-repair protein XRCC4
Organism
fca  Felis catus (domestic cat)
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    101093415 (XRCC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
A1
AA seq 190 aa AA seqDB search
FRLGSFNLEKVASPAEVIRKLICDCLDTIAENQAKNEHLQKENERLLRDWNDIQGRFEKC
VSAKEALETDLYKRFILVLNEKKAKIRSLHKLLNEVQEPERNIEREREATTCSEMTADRD
AVYDESTDEESENLPDPSVLAPATSRDDSIISSPDVTDIAPSRKRRQRMQKNLGTEPKMA
SQVTQPQEKE
NT seq 572 nt NT seq  +upstreamnt  +downstreamnt
tttagacttggttccttcaatctagagaaagttgcaagtccagctgaggtcattaggaaa
cttatttgtgattgcctggacaccattgcggaaaaccaagccaaaaatgagcacctgcag
aaggaaaatgaaaggcttctgagagattggaatgatattcaaggacgatttgaaaaatgt
gtgagtgctaaggaagctttggagactgatctttataagcggtttattctagtgctgaat
gagaagaaagcaaagatcagaagcttgcataaattgttaaatgaagttcaagaaccagaa
aggaacattgagcgtgaaagggaagccacaacatgttctgaaatgaccgctgatagagat
gcagtctacgatgaaagtactgatgaagaaagtgagaacctgcctgatccctctgtgtta
gctccagctacttctagagatgattccatcatttcaagtcctgatgtcactgatattgca
ccaagtagaaagaggaggcagcggatgcaaaaaaatcttggaacagaacctaaaatggct
tctcaggtgactcagcctcaagaaaaggaaaa

DBGET integrated database retrieval system