KEGG   Felis catus (domestic cat): 101093580Help
Entry
101093580         CDS       T02385                                 

Gene name
THBS3
Definition
thrombospondin 3
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101093580 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101093580 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101093580 (THBS3)
  Cellular commiunity
   04510 Focal adhesion
    101093580 (THBS3)
 Human Diseases
  Infectious diseases
   05144 Malaria
    101093580 (THBS3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101093580 (THBS3)
  Exosomal proteins of colorectal cancer cells
   101093580 (THBS3)
  Exosomal proteins of bladder cancer cells
   101093580 (THBS3)
Heparan sulfate/heparin binding proteins [BR:fca00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  101093580 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
F1
AA seq 948 aa AA seqDB search
METQELRGALALLLLCTLACASQDLQVIDLLTVGESRQMTAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSLALQLYVDCKLGDQHAGLPGLAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHRAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRCGPCPPGLQ
GNGTHCSDINECAHADPCFPGVSCINTMPGFRCEACPQGYKGTRVSGVGIDYARASKQVC
QDIDECSDGNNGGCDPNSICTNTVGSFKCGPCRLGFVGNQSQGCVPARTCHSPAHSPCHV
HAHCLFERNGAVSCSCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQDNCLLTPN
SGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPNVPNN
DQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSCPEMSNPT
QTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDGDDDNDGI
PDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAEVTLTDFRA
YQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTD
DDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEHLRNA
LWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQLVADSGVII
DTAMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRA
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctctgcactctcgcatgt
gccagtcaggacctgcaggtgattgacctgctgactgtgggcgagtctcggcagatgacc
gctgtggcagagaagatccggaccgccctgctcactgctggggacatctacctcttgtcc
accttccgcctgccccccaaacagggtggtgtcctctttggcctctactctcggcaggac
aacacacgatggctggaggcctctgttgtgggcaaaatcaacaaagtgctggtgcggtac
cagcgggaggacggcaaggtccacgcggtgaacctgcagcaggcgggcctggccgacggg
cgcacgcacacggctctcctgcgactccgaggtccctcccgacccagcctcgccctgcag
ctctacgtggactgcaaactgggtgaccagcacgccgggctcccagggctggcccccatt
cctccagcggaggtggacgggctggagattaggaccggacagaaggcttatttgaggatg
cagggctttgtggagtctatgaaaatgattctgggcgggtccatggcccgggtgggagcc
ctgagtgagtgtccgttccagggggacgagtccatccacagagcagtgaccaacgcgctc
cattccatcctgggggagcagaccaaggcgctggtcacccagctcaccctcttcaaccag
atcctggtggagctgcgggatgacatccgagaccagaacaccatcatggagtgtcaggtg
tgcggcttccacgagcagcgttcacactgcagccccaacccctgcttccgcggcgtggac
tgcatggaggtgtatgagtaccccggctaccgctgcgggccctgcccccccggcctgcag
ggaaatggcacccactgcagcgacatcaatgagtgtgcccacgcggacccttgttttcct
ggtgtcagctgcatcaacaccatgcccggcttccgctgtgaggcctgtccccagggctac
aaaggcacgcgggtgtccggtgtgggtattgactacgcccgcgccagcaaacaggtctgc
caggacatcgacgaatgcagtgacggtaacaacggtggctgcgaccccaactccatctgc
accaacactgtgggttccttcaagtgtggtccctgtcgcctgggcttcgtgggcaaccag
agccagggctgcgtccccgcccgcacctgccacagcccagcccacagcccctgccacgtc
cacgcgcactgtctctttgaacgcaacggggccgtgtcctgctcgtgtaacgtgggctgg
gccgggaacgggaacgtgtgtgggaccgacacggacatcgacggctacccggaccaggcc
ctgccctgcatggacaacaacaaacattgcaagcaggacaattgccttttgacccccaac
tctggccaggaagatgctgataacgatggcgtgggggaccagtgcgacgatgatgccgat
ggcgatgggatcaagaatgtcgaggacaactgccggctcttccccaacaaggaccagcaa
aactcagatacagattcattcggggatgcctgtgacaactgccccaacgttcccaacaat
gaccagaaggacacggatggcaatggggaaggggatgcctgtgacaacgacgtggacggg
gacggtatccctaacggactggacaattgccctaaagtccccaaccccctgcagacagac
agggatgaggacggggtgggagatgcgtgtgacagctgccctgaaatgagcaatcccact
cagacagatgcagacagcgacctggtgggggatgtctgtgacaccaacgaggacagcgac
ggggatggacatcaggacaccaaggacaactgcccacagctgccaaacagctcccagctg
gactctgacaacgacggccttggagatgagtgtgacggggacgatgacaacgacgggatc
ccagattatgtgcctcctggtcccgacaactgtcgcctggttcccaatcccaatcagaag
gactcagatggcaatggcgtcggtgacgtgtgtgaggatgactttgacaatgatgcggtg
gttgaccccctggacgtgtgtcccgaaagtgcggaggtgaccctcacggattttcgggcc
tatcagacggttgtcctggatcctgagggcgatgcccagattgacccaaactgggtggtg
ctcaaccagggcatggaaatcgttcagaccatgaacagtgaccccggcctggccgttgga
tacacagccttcaacggtgtggacttcgaaggcaccttccacgtgaacacggtcacagat
gacgactacgcaggctttctcttcagctatcaggacagcggccgcttctacgtggtcatg
tggaagcagacggagcagacgtattggcaggccacccctttccgggcggtggctcagccc
gggctgcagctcaaggcagtgacatccgtgtctggcccaggtgaacatctccggaatgcc
ctgtggcacactggccacacccccgaccaggtgcgactgctgtggactgacccccggaac
gtgggctggcgggacaagacctcctaccgctggcagctactgcaccggcctcaagtcggc
tacattcgggtgaagctctatgagggccctcagctggtggcagactccggggtgatcatt
gacacggccatgcgaggggggcgccttggcgtattctgcttctcccaagaaaacatcatt
tggtccaacctccagtatcgatgcaatgacaccgtgcccgaggacttcgagccattccgg
aggcagctgctccagggaagagcgtga

DBGET integrated database retrieval system