KEGG   Felis catus (domestic cat): 101093580Help
Entry
101093580         CDS       T02385                                 

Gene name
THBS3
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombospondin-3
  KO
K04659  thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca05144  Malaria
fca05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101093580 (THBS3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101093580 (THBS3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101093580 (THBS3)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101093580 (THBS3)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    101093580 (THBS3)
   05144 Malaria
    101093580 (THBS3)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101093580 (THBS3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101093580 (THBS3)
  Exosomal proteins of colorectal cancer cells
   101093580 (THBS3)
  Exosomal proteins of bladder cancer cells
   101093580 (THBS3)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   101093580 (THBS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF_MSP1_1
Motif
Other DBs
NCBI-GeneID: 101093580
NCBI-ProteinID: XP_023103149
Ensembl: ENSFCAG00000006584
Position
F1
AA seq 956 aa AA seqDB search
METQELRGALALLLLCTLACASQDLQVIDLLTVGESRQMTAVAEKIRTALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPSRPSLALQLYVDCKLGDQHAGLPGLAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHRAVTNALHSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCSDINECAHADPCFPGVSCINTMPGFRCEACPQGYKGTRVSGVGIDY
ARASKQVCQDIDECSDGNNGGCDPNSICTNTVGSFKCGPCRLGFVGNQSQGCVPARTCHS
PAHSPCHVHAHCLFERNGAVSCSCNVGWAGNGNVCGTDTDIDGYPDQALPCMDNNKHCKQ
DNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACD
NCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDS
CPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECD
GDDDNDGIPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAE
VTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGT
FHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQAXPFRAVAQPGLQLKAVTSVSG
PGEHLRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQL
VADSGVIIDTAMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQGRA
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctctgcactctcgcatgt
gccagtcaggacctgcaggtgattgacctgctgactgtgggcgagtctcggcagatgacc
gctgtggcagagaagatccggaccgccctgctcactgctggggacatctacctcttgtcc
accttccgcctgccccccaaacagggtggtgtcctctttggcctctactctcggcaggac
aacacacgatggctggaggcctctgttgtgggcaaaatcaacaaagtgctggtgcggtac
cagcgggaggacggcaaggtccacgcggtgaacctgcagcaggcgggcctggccgacggg
cgcacgcacacggctctcctgcgactccgaggtccctcccgacccagcctcgccctgcag
ctctacgtggactgcaaactgggtgaccagcacgccgggctcccagggctggcccccatt
cctccagcggaggtggacgggctggagattaggaccggacagaaggcttatttgaggatg
cagggctttgtggagtctatgaaaatgattctgggcgggtccatggcccgggtgggagcc
ctgagtgagtgtccgttccagggggacgagtccatccacagagcagtgaccaacgcgctc
cattccatcctgggggagcagaccaaggcgctggtcacccagctcaccctcttcaaccag
atcctggtggagctgcgggatgacatccgagaccaggtgaaggaaatgtccctgatccga
aacaccatcatggagtgtcaggtgtgcggcttccacgagcagcgttcacactgcagcccc
aacccctgcttccgcggcgtggactgcatggaggtgtatgagtaccccggctaccgctgc
gggccctgcccccccggcctgcagggaaatggcacccactgcagcgacatcaatgagtgt
gcccacgcggacccttgttttcctggtgtcagctgcatcaacaccatgcccggcttccgc
tgtgaggcctgtccccagggctacaaaggcacgcgggtgtccggtgtgggtattgactac
gcccgcgccagcaaacaggtctgccaggacatcgacgaatgcagtgacggtaacaacggt
ggctgcgaccccaactccatctgcaccaacactgtgggttccttcaagtgtggtccctgt
cgcctgggcttcgtgggcaaccagagccagggctgcgtccccgcccgcacctgccacagc
ccagcccacagcccctgccacgtccacgcgcactgtctctttgaacgcaacggggccgtg
tcctgctcgtgtaacgtgggctgggccgggaacgggaacgtgtgtgggaccgacacggac
atcgacggctacccggaccaggccctgccctgcatggacaacaacaaacattgcaagcag
gacaattgccttttgacccccaactctggccaggaagatgctgataacgatggcgtgggg
gaccagtgcgacgatgatgccgatggcgatgggatcaagaatgtcgaggacaactgccgg
ctcttccccaacaaggaccagcaaaactcagatacagattcattcggggatgcctgtgac
aactgccccaacgttcccaacaatgaccagaaggacacggatggcaatggggaaggggat
gcctgtgacaacgacgtggacggggacggtatccccaacggactggacaattgccctaaa
gtccccaaccccctgcagacagacagggatgaggacggggtgggagatgcgtgtgacagc
tgccctgaaatgagcaatcccactcagacagatgcagacagcgacctggtgggggatgtc
tgtgacaccaacgaggacagcgacggggatggacatcaggacaccaaggacaactgccca
cagctgccaaacagctcccagctggactctgacaacgacggccttggagatgagtgtgac
ggggacgatgacaacgacgggatcccagattatgtgcctcctggtcccgacaactgtcgc
ctggttcccaatcccaatcagaaggactcagatggcaatggtgtcggtgacgtgtgtgag
gatgactttgacaatgatgcggtggttgaccccctggacgtgtgtcccgaaagtgcggag
gtgaccctcacggattttcgggcctatcagacggttgtcctggatcctgagggcgatgcc
cagattgacccaaactgggtggtgctcaaccagggcatggaaatcgttcagaccatgaac
agtgaccccggcctggccgttggatacacagccttcaacggtgtggacttcgaaggcacc
ttccacgtgaacacggtcacagatgacgactacgcaggctttctcttcagctatcaggac
agcggccgcttctacgtggtcatgtggaagcagacggagcagacgtattggcaggccnac
cccttccgggcggtggctcagcccgggctgcagctcaaggcagtgacatccgtgtctggc
ccaggtgaacatctccggaatgccctgtggcacactggccacacccccgaccaggtgcga
ctgctgtggactgacccccggaacgtgggctggcgggacaagacctcctaccgctggcag
ctactgcaccggcctcaagtcggctacattcgggtgaagctctatgagggccctcagctg
gtggcagactccggggtgatcattgacacggccatgcgaggggggcgccttggcgtattc
tgcttctcccaagaaaacatcatttggtccaacctccagtatcgatgcaatgacaccgtg
cccgaggacttcgagccgttccggaggcagctgctccagggaagagcgtga

DBGET integrated database retrieval system