KEGG   Felis catus (domestic cat): 101093604Help
Entry
101093604         CDS       T02385                                 

Gene name
UCHL1
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase isozyme L1
  KO
K05611  ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca05012  Parkinson's disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    101093604 (UCHL1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101093604 (UCHL1)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101093604 (UCHL1)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    101093604 (UCHL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 101093604
NCBI-ProteinID: XP_011280215
UniProt: A0A2I2U743
Position
B1
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLSRLGVAGQWRFADVLGLEEEALGSVPAPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGTSSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctcaaaccgatggagattaaccccgagatgctgaacaaagtgctgtcccggctg
ggggtcgccggccagtggcgcttcgcggacgtgctggggctggaggaggaggctctgggc
tcggtgcccgctcccgcctgcgcgctgctgctgctgtttcccctcacggcccagcatgag
aacttcaggaaaaaacagattgaagaactgaagggacaagaagtcagtcccaaggtgtac
ttcatgaagcagaccatcgggaactcctgtggtaccatcggactgatacatgcagtggcc
aataaccaggacaaactggagtttgaggatgggtcagtcctgaaacagtttctttctgaa
acggagaagctgtcaccggaagacagagcaaaatgctttgagaagaatgaggccattcag
gcagcccatgatgccgtggcccaggaaggccaatgccgggtagatgacaaagtgaatttt
cattttattctgtttaacaacgtggatggccacctctatgaacttgatggacgaatgcct
tttccggtgaaccatggcaccagctcagaggactcattgctgcaggatgccgcgaaggtc
tgcagagaattcactgagcgtgagcaaggggaggtccgcttttctgctgtggcactctgc
aaggcagcctga

DBGET integrated database retrieval system