KEGG   Felis catus (domestic cat): 101093980Help
Entry
101093980         CDS       T02385                                 

Gene name
POP7
Definition
processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
fca  Felis catus (domestic cat)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:fca03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:fca03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E3
AA seq 140 aa AA seqDB search
MAENREPRGAVEAELDPVEYTLRKRLPHRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA
RGQNSCSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP
LTRIRNNSAIHIRVFRVTPK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatcgagagccccgcggggccgtcgaggctgagctggacccggtggagtat
acccttcggaagcggctcccccaccgcctgccccggagacccaatgacatttacgtcaac
atgaagactgactttaaagcccagctggcccgctgccaaaagcttctggacggaggggct
cggggtcagaactcatgcagtgagatctacattcatggcttgggcctggccatcaaccgt
gccatcaacattgctctccagcttcaggctggcagcttcgggtccttgcaggtggctgcc
aatacctccaccgtggagctcgtcgatgagctggaaccagagactgacacccgagagccg
ctgacccgcatccgcaacaactcggccatccacatccgtgttttcagggttacacccaag
taa

DBGET integrated database retrieval system