KEGG   Felis catus (domestic cat): 101093980Help
Entry
101093980         CDS       T02385                                 

Gene name
POP7
Definition
processing of precursor 7, ribonuclease P/MRP subunit (S. cerevisiae)
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
fca  Felis catus (domestic cat)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101093980 (POP7)
   03008 Ribosome biogenesis in eukaryotes
    101093980 (POP7)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     101093980 (POP7)
Ribosome biogenesis [BR:fca03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     101093980 (POP7)
Transfer RNA biogenesis [BR:fca03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    101093980 (POP7)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    101093980 (POP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E3
AA seq 140 aa AA seqDB search
MAENREPRGAVEAELDPVEYTLRKRLPHRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA
RGQNSCSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP
LTRIRNNSAIHIRVFRVTPK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatcgagagccccgcggggccgtcgaggctgagctggacccggtggagtat
acccttcggaagcggctcccccaccgcctgccccggagacccaatgacatttacgtcaac
atgaagactgactttaaagcccagctggcccgctgccaaaagcttctggacggaggggct
cggggtcagaactcatgcagtgagatctacattcatggcttgggcctggccatcaaccgt
gccatcaacattgctctccagcttcaggctggcagcttcgggtccttgcaggtggctgcc
aatacctccaccgtggagctcgtcgatgagctggaaccagagactgacacccgagagccg
ctgacccgcatccgcaacaactcggccatccacatccgtgttttcagggttacacccaag
taa

DBGET integrated database retrieval system