KEGG   Felis catus (domestic cat): 101094032Help
Entry
101094032         CDS       T02385                                 

Gene name
USP48
Definition
ubiquitin specific peptidase 48
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101094032 (USP48)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101094032 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 1033 aa AA seqDB search
RLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGEHIW
LGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLCPST
CSDYVMGDSIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQ
EFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELELNI
QGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFVFDR
QTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKDPQS
GEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRLQTQ
EKPNTIVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGA
EPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYG
GGPRLTVKALCKECVVERCRVLRLKNQLNEDYKTVNNLLKATVKGNDGFWVGKSSLRSWR
QLALEQLDEQDGDVDQSNGKMNGNTLNKEESKEERKEEEEELNFNEDILCPHGELCISEN
ERRLVSKDAWNKLQQYFPKAPEFPSYRECCSQCKILEREGEENEALHKMIANEQKTSLPN
LFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLM
FTFASMTKEDSKLIALIWPGEWQMIQKLFVVDHVIKITRTEVGDVNPSETQYISEPKLCP
ECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSVPELNVSSSETEEDKEEAKPDGE
KDPDFNQSNGGTKRQKITHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQI
MHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCM
PEEGFKGTGLLGH
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
cggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggcccgaggaggtg
tcgcaggagcacatcgagaccgcgtaccgcatctggctggagccttgcatccgcggcgtg
tgcagacgaaactgcaaaggaaatccaaattgcttggttgggattggtgagcatatttgg
ttaggagaaatagatgaaaatagtttccataacattgatgatcccaactgtgagaggaga
aaaaagaactcatttgtgggcctcactaaccttggagctacttgttacgtcaacacgttt
cttcaagtgtggtttctcaacttggagcttcggcaggcactatacttatgtccaagtacc
tgtagcgactacgtgatgggagatagtatccaagaggagaaagattatgaacctcagaca
atttgtgagcatctccagtacttgtttgccttgttgcaaaacagtaacaggcgatacatc
gatccatcgggatttgttaaagccttgggcttggacacaggacaacagcaggatgcccaa
gaattttcaaagctatttatgtctcttttggaagatactttgtctaaacaaaagaatcca
gatgtgcggaacattgtccagcagcaattctgtggagaatatgcttatgtaactgtttgc
aaccagtgtggcagagagtctaagcttttatcaaagttttatgaactggagttaaatatc
caaggccataaacagttaacagattgtatctcggaatttttgaaggaagaaaaattagaa
ggagacaatcgatacttttgtgaaaactgtcaaagtaaacagaatgcaacaaggaagatc
agactcctcagccttccctgcaccctgaacttacagctgatgcgctttgtctttgacagg
caaactggacataagaaaaagctgaatacctacattggcttctcagaaattttggatatg
gagccttatgtggaacataaaggtgggtcctatgtgtatgaactgagtgcagtccttata
cacagaggagtgagtgcttattctggccactacattgcccatgtgaaagatccacagtcc
ggtgaatggtataagtttaatgacgaagacatagaaaagatggaggggaagaaattacaa
ctagggattgaggaagatctagcagaaccttctaagtcccagacacgtaaacccaagtgt
ggcaaaggaactcactgctctcgaaatgcatacatgttggtgtatagactacaaactcaa
gaaaaacccaacacaattgttcaggtaccagcctttcttcaagagctggtagatcgggat
aattccaagtttgaggagtggtgtattgaaatggccgagatgcgtaagcaaagtgtggat
aaaggaaaagcaaaacacgaagaggttaaggagctgtaccaaaggttacctgctggagct
gagccctatgaatttgtctctctcgagtggctacagaaatggttggatgaatcgacaccc
accaagcctatcgataatcacgcttgcctgtgttcccatgacaagcttcatcctgataag
atatcaattatgaagagaatatctgaatatgcggctgacattttctatagtagatatgga
ggaggaccaagactaactgtgaaagccctgtgtaaggagtgtgtggtagaacgttgtcgt
gtgttacgtctgaagaatcaactaaatgaagactataaaactgtcaataatctgctaaaa
gcaacagtaaagggcaatgacgggttttgggtagggaaatcttccttgcgcagctggcgc
cagctggctctcgagcaattagacgaacaagatggggacgtcgaccaaagcaacgggaag
atgaacggcaacaccttaaataaagaggaatcaaaagaagaaaggaaagaagaggaggag
gaattaaattttaatgaagacattctgtgcccacatggggagttatgcatatctgaaaac
gaaagacgacttgtttctaaagacgcttggaacaaactgcaacagtactttccaaaggct
cctgagtttccaagttacagagaatgctgctcacagtgcaagattttagaaagagaaggg
gaagaaaatgaagccttacataagatgattgcaaacgagcaaaagacttctcttccgaat
ttgttccaggacaagaacagaccatgtctcagtaactggccagaggatacagatgtcctg
tacattgtgtcacagttctttgtagaagaatggcggaaatttgtcagaaaacccacaaga
tgtagtcccgtgtcatcggttggaaacagtgctcttctgtgcccccatgggggactcatg
tttacatttgcttccatgaccaaagaagattctaaacttatagctctcatatggcccggc
gagtggcaaatgattcaaaagctctttgtcgtggatcatgtaattaaaatcacaagaact
gaagtgggagatgtaaacccttcagaaacacagtatatttctgagccaaaactctgtcca
gaatgcagagagggcttattatgtcaacagcagagggacctacgtgaatacactcaagcc
accatctacgtccataaagttgtggataataaaaaggtgatgaaggattcagttccggag
ctgaatgtgagtagttctgaaacagaggaggataaggaagaagctaaaccagatggagaa
aaagatcctgattttaatcaaagcaatggagggacgaagcggcaaaagataacccatcag
aattacatagcctatcaaaagcaagtcattcggcgcagtatgcgacatagaaaagtccgt
ggtgagaaagcacttcttgtttctgctaatcagacactaaaagaattgaaaattcagatc
atgcacgcgttttcagttgctccttttgaccagaatctgtcaattgatggaaagatttta
agtgatgactgtgccaccctcggcacccttggcgtcattcccgaatctgtgattttgtta
aaggccgatgaaccgattgcagattatgctgcaatggatgatgtcatgcaagtgtgtatg
ccagaagaagggtttaaaggtactggtctacttggacattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system