KEGG   Felis catus (domestic cat): 101094032Help
Entry
101094032         CDS       T02385                                 

Gene name
USP48
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 48 isoform X1
  KO
K11858  ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101094032 (USP48)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101094032 (USP48)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101094032 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUSP ubiquitin
Motif
Other DBs
NCBI-GeneID: 101094032
NCBI-ProteinID: XP_023114037
Ensembl: ENSFCAG00000002963
Position
C1
AA seq 1046 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYVMGDSIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKPNTIVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAGLSKCFTYLIFYIQQHPCEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRI
SEYAADIFYSRYGGGPRLTVKALCKECVVERCRVLRLKNQLNEDYKTVNNLLKATVKGND
GFWVGKSSLRSWRQLALEQLDEQDGDVDQSNGKMNGNTLNKEESKEERKEEEEELNFNED
ILCPHGELCISENERRLVSKDAWNKLQQYFPKAPEFPSYRECCSQCKILEREGEENEALH
KMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSV
GNSALLCPHGGLMFTFASMTKEDSKLIALIWPGEWQMIQKLFVVDHVIKITRTEVGDVNP
SETQYISEPKLCPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSVPELNVSSSE
TEEDKEEAKPDGEKDPDFNQSNGGTKRQKITHQNYIAYQKQVIRRSMRHRKVRGEKALLV
SANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIA
DYAAMDDVMQVCMPEEGFKGTGLLGH
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcgtaccgcatctggctggagccttgcatc
cgcggcgtgtgcagacgaaactgcaaaggaaatccaaattgcttggttgggattggtgag
catatttggttaggagaaatagatgaaaatagtttccataacattgacgatcccaactgt
gagaggagaaaaaagaactcatttgtgggcctcactaaccttggagctacttgttacgtc
aacacgtttcttcaagtgtggtttctcaacttggagcttcggcaggcactatacttatgt
ccaagtacctgtagcgactacgtgatgggagatagtatccaagaggagaaagattatgaa
cctcagacaatttgtgagcatctccagtacttgtttgccttgttgcaaaacagtaacagg
cgatacatcgatccatcgggatttgttaaagccttgggcttggacacaggacaacagcag
gatgcccaagaattttcaaagctatttatgtctcttttggaagatactttgtctaaacaa
aagaatccagatgtgcggaacattgtccagcagcaattctgtggagaatatgcttatgta
actgtttgcaaccagtgtggcagagagtctaagcttttatcaaagttttatgaactggag
ttaaatatccaaggccataaacagttaacagattgtatctcggaatttttgaaggaagaa
aaattagaaggagacaatcgatacttttgtgaaaactgtcaaagtaaacagaatgcaaca
aggaagatcagactcctcagccttccctgcaccctgaacttacagctgatgcgctttgtc
tttgacaggcaaactggacataagaaaaagctgaatacctacattggcttctcagaaatt
ttggatatggagccttatgtggaacataaaggtgggtcctatgtgtatgaactgagtgca
gtccttatacacagaggagtgagtgcttattctggccactacattgcccatgtgaaagat
ccacagtccggtgaatggtataagtttaatgacgaagacatagaaaagatggaggggaag
aaattacaactagggattgaggaagatctagcagaaccttctaagtcccagacacgtaaa
cccaagtgtggcaaaggaactcactgctctcgaaatgcatacatgttggtgtatagacta
caaactcaagaaaaacccaacacaattgttcaggtaccagcctttcttcaagagctggta
gatcgggataattccaagtttgaggagtggtgtattgaaatggccgagatgcgtaagcaa
agtgtggataaaggaaaagcaaaacacgaagaggttaaggagctgtaccaaaggttacct
gctggagctggtctctcaaaatgcttcacatatcttatcttttacattcaacaacatccc
tgtgagtggctacagaaatggttggatgaatcgacacccaccaagcctatcgataatcac
gcttgcctgtgttcccatgacaagcttcatcctgataagatatcaattatgaagagaata
tctgaatatgcggctgacattttctatagtagatatggaggaggaccaagactaactgtg
aaagccctgtgtaaggagtgtgtggtagaacgttgtcgtgtgttacgtctgaagaatcaa
ctaaatgaagactataaaactgtcaataatctgctaaaagcaacagtaaagggcaatgac
gggttttgggtagggaaatcttccttgcgcagctggcgccagctggctctcgagcaatta
gacgaacaagatggggacgtcgaccaaagcaacgggaagatgaacggcaacaccttaaat
aaagaggaatcaaaagaagaaaggaaagaagaggaggaggaattaaattttaatgaagac
attctgtgcccacatggggagttatgcatatctgaaaacgaaagacgacttgtttctaaa
gacgcttggaacaaactgcaacagtactttccaaaggctcctgagtttccaagttacaga
gaatgctgctcacagtgcaagattttagaaagagaaggggaagaaaatgaagccttacat
aagatgattgcaaacgagcaaaagacttctcttccgaatttgttccaggacaagaacaga
ccatgtctcagtaactggccagaggatacagatgtcctgtacattgtgtcacagttcttt
gtagaagaatggcggaaatttgtcagaaaacccacaagatgtagtcccgtgtcatcggtt
ggaaacagtgctcttctgtgcccccatgggggactcatgtttacatttgcttccatgacc
aaagaagattctaaacttatagctctcatatggcccggcgagtggcaaatgattcaaaag
ctctttgtcgtggatcatgtaattaaaatcacaagaactgaagtgggagatgtaaaccct
tcagaaacacagtatatttctgagccaaaactctgtccagaatgcagagagggcttatta
tgtcaacagcagagggacctacgtgaatacactcaagccaccatctacgtccataaagtt
gtggataataaaaaggtgatgaaggattcagttccggagctgaatgtgagtagttctgaa
acagaggaggataaggaagaagctaaaccagatggagaaaaagatcctgattttaatcaa
agcaatggagggacgaagcggcaaaagataacccatcagaattacatagcctatcaaaag
caagtcattcggcgcagtatgcgacatagaaaagtccgtggtgagaaagcacttcttgtt
tctgctaatcagacactaaaagaattgaaaattcagatcatgcacgcgttttcagttgct
ccttttgaccagaatctgtcaattgatggaaagattttaagtgatgactgtgccaccctc
ggcacccttggcgtcattcccgaatctgtgattttgttaaaggccgatgaaccgattgca
gattatgctgcaatggatgatgtcatgcaagtgtgtatgccagaagaagggtttaaaggt
actggtctacttggacattaa

DBGET integrated database retrieval system