KEGG   Felis catus (domestic cat): 101094118Help
Entry
101094118         CDS       T02385                                 

Gene name
SETDB1
Definition
SET domain, bifurcated 1
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101094118 (SETDB1)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101094118 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 1297 aa AA seqDB search
MSSIPGCIGLGAAAAAVESDEIAELQQAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGPLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPTEPPQPTAPPAPPAPPAPPAPPAPPVSPQAGD
NDSLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVPAGKPGSNQTYRSPLGP
TASAPAAPPAPPVPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSAQY
RGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLF
LEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTXPPPQVAYSKERIPG
KGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECL
PTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAG
KILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSG
TEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSRPPDLGP
PHIPVPPAIPGGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGEGRA
GGGRGEAEKASTSGLGFKDEGDLKQAKKEDPDDRNKMSLITESSRNYGYNPSPMKLEGLR
RPPSKTSMHQSRRLMASAQSNADDVLTLSSSTESEGESGTSRKPTTGQTSATAVDSDDIQ
TISSGSEADDFEDKKNMSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPVR
KNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKR
IRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatccctgggtgcattggtttgggtgcagccgcagctgcggtggagtctgat
gagatcgcagagctgcaacaagcagtggttgaggagctgggtatctcaatggaggaactg
aggcagttcatcgatgaagaactggagaagatggactgtgtacagcagcgaaagaagcaa
ctagcggagttggagacgtgggtaatacagaaggaatctgaggtggcccatgttgatcag
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacaataccgggacagtagctctgaggatgaagcctcccggcctaca
gaaataatcgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaacacccaaagaccagaagctccgtgaggctatggctgccttaagaaagtca
gctcaagatgtccagaagttcatggatgctgtcaacaaaaagagcagctcccaagatcta
cataaaggaaccttgagtcagatgtctggagaactgagcaaagatggtgacctaatagtc
agcatgcgcatcctgggcaagaagagaactaagacatggcacaaaggcacccttattgcc
atccagacggtcggaccaggaaagaagtacaaggtgaaatttgacaacaaagggaagagt
ctactgtcagggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgagtggtggccaagtacaaggatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggg
tacgcttcctatgtcacacaatctgaactgtatcccatttgccggccactgaaaaagaca
tgggaggacatagaagacatctcctgccgagacttcatagaggagtacatcacagcctac
cccaaccgccctatggtgctactcaagagtggccagcttatcaagactgagtgggaaggc
acatggtggaagtcccgggtcgaggaggtggacggcagcctagtcaggatcctcttcctg
gatgacaaaagatgcgaatggatctatcgaggctccacgcggctagagcccatgttcagc
atgaagacctcctcagcctccgcactagagaagaagcaagggggaccactcaggacacgt
ccaaatatgggtgctgtgaggagcaaaggccctgtggtccagtacacccaggatctgacc
agtactgggacccagttcaagccaacggagcccccacagcctacagcccctcctgctccc
cctgccccccctgctccccctgccccccctgctccccctgtgtccccgcaggcaggtgac
aatgacagcttggaaagtcagcttgcccaatctcggaagcaggtagccaaaaagagcaca
tccttccgaccaggatctgtgggctctggtcattcctcccctacatctcctgcactcagt
gaaaatgttcctgctgggaaacctgggagcaaccagacatatagatcacctttaggccca
acagcctctgccccagcagcgcccccagcacctcccgtgcccccagccttccatggcatg
ttagaacgggccccagcggaaccctcctaccgtgcccccatggagaagctcttctattta
cctcatgtgtgcagctatacgtgtctgtctcgagttagacctatgagaagtgcacagtac
cggggcaagaacccactgctggtcccgctgctctatgacttccggcggatgacagcccgt
cgccgagttaaccgcaagatgggctttcacgtgatctataagacaccctgtggcctctgc
cttcggacaatgcaggagattgaacgctatctttttgagactggctgtgacttcctcttc
ctggagatgttctgtttggatccatatgttcttgtggaccgcaagtttcagccctataaa
cctttttactacattctggacatcacctatgggaaggaagatgtccccctatcctgtgtc
aatgagattgacacanaccccccaccccaggtggcctatagtaaggaacgaatccctggc
aagggtgttttcattaacacaggcccagaatttctggtcggctgtgactgcaaggatggg
tgccgtgacaagtccaagtgtgcctgtcatcagctaactatccaggccacagcctgtacc
ccgggcggccagatcaaccctaattctggctaccagtacaagagactagaagagtgtctg
cccacaggagtttatgagtgcaacaaacgttgtaaatgtgacccaaacatgtgcacaaac
cggttggtgcagcacggactccaggttcggctacagctattcaagacacagaacaagggc
tggggtattcgctgcttggatgacattgccaaaggatccttcgtctgtatttatgcaggc
aagatcctgacagatgactttgcggacaaggagggcctggagatgggtgatgagtacttt
gccaatctggaccatatcgagagtgtggagaacttcaaggaaggatatgagagtgatgcc
ccctgttcgtccgacagcagcggggtggacttgaaggaccaggaagatggcaacagcggt
acagaggatcccgaagagtccaatgacgacagttccgatgataacttctgtaaagatgag
gacttcagtaccagctctgtgtggcgcagctatgctacccggaggcagacccggggccaa
aaggagaacggactgtctgagacggcttccaaggactcccgccccccagaccttggcccc
ccccatattcctgtccctccagcgatccctgggggtggctgcaatccgccttcctctgaa
gagacacccaagaataaggtggcctcatggttgagctgcaatagtgtcagtgaaggtggc
tttgctgactctgatagccgttcatccttcaagactagcgaaggtggggaaggccgggct
gggggaggcagaggggaggctgagaaggcctccacctcagggctgggcttcaaggatgag
ggagatctcaagcaggccaagaaagaggaccccgatgaccgaaacaagatgtccttaatc
actgaaagctctcgaaattatggttacaatccttctcccatgaaacttgaaggacttcgc
cgcccacctagtaagactagtatgcatcagagccgacgactcatggcctctgctcagtcc
aacgctgatgatgtcttaacactgtccagcagcacagaaagcgagggggaaagtgggacc
agccggaagcctaccaccggccagacttcagccacagcagtggacagcgatgatatccag
accatctcctctggctctgaagcagatgactttgaggacaagaagaacatgtctggtcca
acaaagcgccaggtggcagtaaaatcaacccggggctttgctcttaagtcaacccatggg
attgccattaaatcaaccaacatggcatccgtggaaaagggggagagcgcacctgtccgt
aagaacacacgccagttctacgatggggaggagtcttgctacatcatcgacgccaagctc
gaaggcaacctgggccgctacctcaatcacagctgcagccccaacctgtttgtccagaat
gtctttgtggacactcacgatcttcgcttcccctgggtggccttctttgccagcaagagg
atccgggccgggaccgagctgacttgggactacaactatgaggtgggcagtgtggaaggc
aaggagctgctgtgctgctgcggggccattgaatgcagggggcggcttctttag

DBGET integrated database retrieval system