KEGG   Felis catus (domestic cat): 101094118Help
Entry
101094118         CDS       T02385                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain, bifurcated 1
  KO
K11421  
histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101094118 (SETDB1)
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    101094118 (SETDB1)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101094118 (SETDB1)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101094118 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101094118 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 1297 aa AA seqDB search
MSSIPGCIGLGAAAAAVESDEIAELQQAVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGPLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPTEPPQPTAPPAPPAPPAPPAPPAPPVSPQAGD
NDSLESQLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVPAGKPGSNQTYRSPLGP
TASAPAAPPAPPVPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSAQY
RGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLF
LEMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPG
KGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECL
PTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAG
KILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSG
TEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETASKDSRPPDLGP
PHIPVPPAIPGGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSEGGEGRA
GGGRGEAEKASTSGLGFKDEGDLKQAKKEDPDDRNKMSLITESSRNYGYNPSPMKLEGLR
RPPSKTSMHQSRRLMASAQSNADDVLTLSSSTESEGESGTSRKPTTGQTSATAVDSDDIQ
TISSGSEADDFEDKKNMSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPVR
KNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKR
IRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3894 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatccctgggtgcattggtttgggtgcagccgcagctgcggtggagtctgat
gagatcgcagagctgcaacaagcagtggttgaggagctgggtatctcaatggaggaactg
aggcagttcatcgatgaagaactggagaagatggactgtgtacagcagcgaaagaagcaa
ctagcggagttggagacgtgggtaatacagaaggaatctgaggtggcccatgttgatcag
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacaataccgggacagtagctctgaggatgaagcctcccggcctaca
gaaataatcgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaacacccaaagaccagaagctccgtgaggctatggctgccttaagaaagtca
gctcaagatgtccagaagttcatggatgctgtcaacaaaaagagcagctcccaagatcta
cataaaggaaccttgagtcagatgtctggagaactgagcaaagatggtgacctaatagtc
agcatgcgcatcctgggcaagaagagaactaagacatggcacaaaggcacccttattgcc
atccagacggtcggaccaggaaagaagtacaaggtgaaatttgacaacaaagggaagagt
ctactgtcagggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgagtggtggccaagtacaaggatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggg
tacgcttcctatgtcacacaatctgaactgtatcccatttgccggccactgaaaaagaca
tgggaggacatagaagacatctcctgccgagacttcatagaggagtacatcacagcctac
cccaaccgccctatggtgctactcaagagtggccagcttatcaagactgagtgggaaggc
acatggtggaagtcccgggtcgaggaggtggacggcagcctagtcaggatcctcttcctg
gatgacaaaagatgcgaatggatctatcgaggctccacgcggctagagcccatgttcagc
atgaagacctcctcagcctccgcactagagaagaagcaagggggaccactcaggacacgt
ccaaatatgggtgctgtgaggagcaaaggccctgtggtccagtacacccaggatctgacc
agtactgggacccagttcaagccaacggagcccccacagcctacagcccctcctgctccc
cctgccccccctgctccccctgccccccctgctccccctgtgtccccgcaggcaggtgac
aatgacagcttggaaagtcagcttgcccaatctcggaagcaggtagccaaaaagagcaca
tccttccgaccaggatctgtgggctctggtcattcctcccctacatctcctgcactcagt
gaaaatgttcctgctgggaaacctgggagcaaccagacatatagatcacctttaggccca
acagcctctgccccagcagcgcccccagcacctcccgtgcccccagccttccatggcatg
ttagaacgggccccagcggaaccctcctaccgtgcccccatggagaagctcttctattta
cctcatgtgtgcagctatacgtgtctgtctcgagttagacctatgagaagtgcacagtac
cggggcaagaacccactgctggtcccgctgctctatgacttccggcggatgacagcccgt
cgccgagttaaccgcaagatgggctttcacgtgatctataagacaccctgtggcctctgc
cttcggacaatgcaggagattgaacgctatctttttgagactggctgtgacttcctcttc
ctggagatgttctgtttggatccatatgttcttgtggaccgcaagtttcagccctataaa
cctttttactacattctggacatcacctatgggaaggaagatgtccccctatcctgtgtc
aatgagattgacacaacccccccaccccaggtggcctatagtaaggaacgaatccctggc
aagggtgttttcattaacacaggcccagaatttctggtcggctgtgactgcaaggatggg
tgccgtgacaagtccaagtgtgcctgtcatcagctaactatccaggccacagcctgtacc
ccgggcggccagatcaaccctaattctggctaccagtacaagagactagaagagtgtctg
cccacaggagtttatgagtgcaacaaacgttgtaaatgtgacccaaacatgtgcacaaac
cggttggtgcagcacggactccaggttcggctacagctattcaagacacagaacaagggc
tggggtattcgctgcttggatgacattgccaaaggatccttcgtctgtatttatgcaggc
aagatcctgacagatgactttgcggacaaggagggcctggagatgggtgatgagtacttt
gccaatctggaccatatcgagagtgtggagaacttcaaggaaggatatgagagtgatgcc
ccctgttcgtccgacagcagcggggtggacttgaaggaccaggaagatggcaacagcggt
acagaggatcccgaagagtccaatgacgacagttccgatgataacttctgtaaagatgag
gacttcagtaccagctctgtgtggcgcagctatgctacccggaggcagacccggggccaa
aaggagaacggactgtctgagacggcttccaaggactcccgccccccagaccttggcccc
ccccatattcctgtccctccagcgatccctgggggtggctgcaatccgccttcctctgaa
gagacacccaagaataaggtggcctcatggttgagctgcaatagtgtcagtgaaggtggc
tttgctgactctgatagccgttcatccttcaagactagcgaaggtggggaaggccgggct
gggggaggcagaggggaggctgagaaggcctccacctcagggctgggcttcaaggatgag
ggagatctcaagcaggccaagaaagaggaccccgatgaccgaaacaagatgtccttaatc
actgaaagctctcgaaattatggttacaatccttctcccatgaaacttgaaggacttcgc
cgcccacctagtaagactagtatgcatcagagccgacgactcatggcctctgctcagtcc
aacgctgatgatgtcttaacactgtccagcagcacagaaagcgagggggaaagtgggacc
agccggaagcctaccaccggccagacttcagccacagcagtggacagcgatgatatccag
accatctcctctggctctgaagcagatgactttgaggacaagaagaacatgtctggtcca
acaaagcgccaggtggcagtaaaatcaacccggggctttgctcttaagtcaacccatggg
attgccattaaatcaaccaacatggcatccgtggaaaagggggagagcgcacctgtccgt
aagaacacacgccagttctacgatggggaggagtcttgctacatcatcgacgccaagctc
gaaggcaacctgggccgctacctcaatcacagctgcagccccaacctgtttgtccagaat
gtctttgtggacactcacgatcttcgcttcccctgggtggccttctttgccagcaagagg
atccgggccgggaccgagctgacttgggactacaactatgaggtgggcagtgtggaaggc
aaggagctgctgtgctgctgcggggccattgaatgcagggggcggcttctttag

DBGET integrated database retrieval system