KEGG   Felis catus (domestic cat): 101094246Help
Entry
101094246         CDS       T02385                                 

Gene name
USP26
Definition
ubiquitin specific peptidase 26
Orthology
K11850  
ubiquitin carboxyl-terminal hydrolase 26/29/37 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101094246 (USP26)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101094246 (USP26)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 920 aa AA seqDB search
MATLMAHGFVHIWSKNVGMSKPKEAYIGKVERKKNIRLLVYFSTGESTTFQLTNNIKNVV
LRSYGGKQNHLHLTFQNNSFLFIEGLSSADAEELKMFLDGFPQNNQPSMKPVKDGGIFAC
TTTQKEINKSSSHEICSKSSSGSLETGEGHGTADLQQKPLCASKSSTLTCNDLPENGQEK
RKRMLSSGSGMGGKFLQKNSSVRDQKFETNLLRYVSHNRKKKLRLKNKKKLAFEHLFETN
STGNPYLEGVSVLQVLCEKIYLAFLLEAKYSADKPEWDRLKMTLDLYPDKLLQGLPNLGN
TCYMNAVLQSLFSIPSFADDLFSKDSPWGKVSLDALSICLAQLFVLKDIYNIKIKERLLA
SLKKTISSVAEIFSDNVQNDAHEFLGHCLDQMKENMGKLNTIWKAKIESEEENPAQQIFP
GSAATEVLVCPIINNFEFELLRSITCQTCGHVVLKTEVNNYLSINLPQGTKSLPLSIQSA
FDLFFGAEELEYKCGKCKHKSSVAVHKFSRLPRVLIVHLKRYTFDEFWSLRKDDQEVVIS
THLDISSHRNETTKPPPPVSKNVLTRDFQILKVFHSMKFGNFFLSTPSTKPTLASNDSLI
PHIGPDKESEPQKCQIPCEGSSNGEQKEDLGKCPKLNITESELVNLGNGAVIEKELLAAG
LMMDLEATSLSQIQKDEGKPTSGLDRCLAEVYLQEMFENLKQKKYETTNTRVDFKSGTET
TEDTYKHEKNRIPKEFQKPTKQTQQDEWMKIYEQALRQALLGALLKTRTRWYAKNLRKPA
KLRLQETKANSLGAPGSNKNPGNKECLKKEKSETEATKPKRSGKMSDLDSYRLIAVVSHL
GKTPNSGHYISDAYDFERQAWFTYNDLQVLSIEEDLMQEARLCTGYIFFYMHNDVFEELL
KREENFQSRNTKARKTAQEK
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggctactctaatggcacacggttttgtccatatatggagcaagaatgtggggatgtct
aagcccaaagaagcatacattggaaaagtggaaagaaagaagaatattagactgctggtc
tatttcagcactggagaatcaacaacttttcaactaactaataatattaaaaatgtggtg
cttagatcctatggaggaaaacaaaatcacctgcatttaactttccaaaataatagcttc
ttgtttattgaaggattatcttctgcagatgctgaagagttgaagatgttcttggatgga
ttccctcaaaataatcaaccatccatgaagcctgttaaggatggagggatctttgcctgc
acaacaacacagaaggaaatcaacaaaagttcatctcacgaaatatgtagtaagtcaagt
agtggatctttagagacaggagaaggacatggaacagccgaccttcagcagaagcctttg
tgtgcatcaaagtcatcaacacttacttgcaatgatttaccagaaaatggacaggagaag
agaaaaagaatgttatcatctggttcagggatgggtgggaaattcctgcaaaagaatagc
tctgtaagagatcagaaattcgagacaaatctcttgaggtatgtaagccacaataggaag
aaaaagttgaggttaaaaaataagaagaaattagcatttgaacacttattcgagaccaat
tctactggaaacccttaccttgagggtgttagtgttcttcaggtgctttgtgagaaaata
tatttggcatttctgttggaagcaaagtatagtgcagataagccagagtgggacagactc
aagatgacccttgacttgtacccagataaactattgcaaggcctccccaatttgggaaac
acctgttacatgaacgcagttttacagtccttattttcgattccgtcttttgctgatgat
ttattcagtaaggattccccatggggtaaagtttcccttgatgctcttagcatatgttta
gcacagctgtttgttttgaaagatatttataacataaaaatcaaggagaggttacttgcg
agccttaaaaaaaccatatcatcagttgcagagattttctctgacaacgtacaaaacgat
gctcatgagtttttaggtcactgtttagatcagatgaaagagaacatggggaaattaaac
accatatggaaggctaaaattgaatctgaagaggagaatccagctcaacagatctttcct
ggaagtgctgccactgaagtgctcgtttgtcccatcatcaataattttgagtttgagttg
ctgcgctctattacttgtcaaacctgtggtcatgttgttctcaagaccgaagtgaataat
tatctctccatcaaccttccacaaggaacgaaatcacttcctttgtctattcagtctgct
tttgatctcttctttggagcggaagagcttgaatataaatgtgggaaatgtaagcataag
agttctgttgcagtgcacaaatttagtaggctacccagggttcttattgttcacctgaaa
cgttatacctttgacgagttttggtcgctaaggaaggatgaccaggaagtcgttatttcc
acacatttagatatatcatctcatcgcaatgaaactaccaagccacctcctcctgtgagc
aagaatgtgcttactagggatttccaaatcctaaaagtctttcacagcatgaaatttgga
aacttctttctatcaacaccttcaacaaagccaaccttggcatccaatgattctctgatt
ccacacattggaccagacaaagagtctgaaccacaaaaatgccagattccttgtgaagga
tcatcaaatggagaacagaaagaagacctgggaaaatgtcctaaactgaatataactgag
tctgaattagtaaacttaggaaatggagcagtcattgaaaaagagctattagctgctgga
ttaatgatggatcttgaagcaacgtccctttctcagatccagaaagatgaaggtaaaccc
accagtggtctagacaggtgtcttgccgaagtttatcttcaagaaatgtttgaaaatcta
aaacaaaagaaatatgagacaactaatacgcgtgtagatttcaagagtggcactgagact
actgaagatacttataaacatgaaaaaaacagaattccaaaagaattccaaaaaccgact
aaacagacccagcaggatgaatggatgaaaatctatgaacaagccctgcggcaggcactg
cttggagccctcttgaagacacgtacccgctggtatgcaaagaacctcagaaaacctgca
aaattacgtctccaggagaccaaagcaaattccctaggggcaccgggttccaataaaaac
cctggaaacaaagaatgtttaaagaaggagaagtcagaaactgaagccacaaaaccaaaa
agaagtggtaagatgagtgatctcgattcctatcggctcattgctgttgtcagccatctt
gggaagaccccaaattcaggccattatatcagcgatgcctatgactttgagaggcaagcg
tggttcacttacaatgatctacaggtattgagtatcgaagaagatctcatgcaggaggct
aggctttgcaccgggtacatcttcttttacatgcacaatgatgtttttgaagagctgttg
aaaagggaagagaacttccagtctcgtaacacaaaggcaaggaagaccgctcaggagaag
taa

DBGET integrated database retrieval system