KEGG   Felis catus (domestic cat): 101094274Help
Entry
101094274         CDS       T02385                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04210  Apoptosis
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04218  Cellular senescence
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04611  Platelet activation
fca04620  Toll-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04750  Inflammatory mediator regulation of TRP channels
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca04926  Relaxin signaling pathway
fca04930  Type II diabetes mellitus
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04960  Aldosterone-regulated sodium reabsorption
fca04973  Carbohydrate digestion and absorption
fca05100  Bacterial invasion of epithelial cells
fca05142  Chagas disease (American trypanosomiasis)
fca05146  Amoebiasis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  HTLV-I infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05418  Fluid shear stress and atherosclerosis
Module
fca_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101094274 (PIK3CD)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101094274 (PIK3CD)
   04015 Rap1 signaling pathway
    101094274 (PIK3CD)
   04012 ErbB signaling pathway
    101094274 (PIK3CD)
   04370 VEGF signaling pathway
    101094274 (PIK3CD)
   04630 Jak-STAT signaling pathway
    101094274 (PIK3CD)
   04668 TNF signaling pathway
    101094274 (PIK3CD)
   04066 HIF-1 signaling pathway
    101094274 (PIK3CD)
   04068 FoxO signaling pathway
    101094274 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101094274 (PIK3CD)
   04072 Phospholipase D signaling pathway
    101094274 (PIK3CD)
   04071 Sphingolipid signaling pathway
    101094274 (PIK3CD)
   04024 cAMP signaling pathway
    101094274 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    101094274 (PIK3CD)
   04152 AMPK signaling pathway
    101094274 (PIK3CD)
   04150 mTOR signaling pathway
    101094274 (PIK3CD)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101094274 (PIK3CD)
  Cell growth and death
   04210 Apoptosis
    101094274 (PIK3CD)
   04218 Cellular senescence
    101094274 (PIK3CD)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101094274 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    101094274 (PIK3CD)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101094274 (PIK3CD)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101094274 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    101094274 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101094274 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    101094274 (PIK3CD)
   04660 T cell receptor signaling pathway
    101094274 (PIK3CD)
   04662 B cell receptor signaling pathway
    101094274 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    101094274 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    101094274 (PIK3CD)
   04670 Leukocyte transendothelial migration
    101094274 (PIK3CD)
   04062 Chemokine signaling pathway
    101094274 (PIK3CD)
  Endocrine system
   04910 Insulin signaling pathway
    101094274 (PIK3CD)
   04923 Regulation of lipolysis in adipocyte
    101094274 (PIK3CD)
   04915 Estrogen signaling pathway
    101094274 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101094274 (PIK3CD)
   04917 Prolactin signaling pathway
    101094274 (PIK3CD)
   04926 Relaxin signaling pathway
    101094274 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    101094274 (PIK3CD)
  Digestive system
   04973 Carbohydrate digestion and absorption
    101094274 (PIK3CD)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101094274 (PIK3CD)
  Nervous system
   04725 Cholinergic synapse
    101094274 (PIK3CD)
   04722 Neurotrophin signaling pathway
    101094274 (PIK3CD)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101094274 (PIK3CD)
  Development
   04360 Axon guidance
    101094274 (PIK3CD)
   04380 Osteoclast differentiation
    101094274 (PIK3CD)
  Aging
   04211 Longevity regulating pathway - mammal
    101094274 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    101094274 (PIK3CD)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101094274 (PIK3CD)
   05230 Central carbon metabolism in cancer
    101094274 (PIK3CD)
   05231 Choline metabolism in cancer
    101094274 (PIK3CD)
   05205 Proteoglycans in cancer
    101094274 (PIK3CD)
   05203 Viral carcinogenesis
    101094274 (PIK3CD)
   05210 Colorectal cancer
    101094274 (PIK3CD)
   05212 Pancreatic cancer
    101094274 (PIK3CD)
   05225 Hepatocellular carcinoma
    101094274 (PIK3CD)
   05226 Gastric cancer
    101094274 (PIK3CD)
   05214 Glioma
    101094274 (PIK3CD)
   05221 Acute myeloid leukemia
    101094274 (PIK3CD)
   05220 Chronic myeloid leukemia
    101094274 (PIK3CD)
   05218 Melanoma
    101094274 (PIK3CD)
   05211 Renal cell carcinoma
    101094274 (PIK3CD)
   05215 Prostate cancer
    101094274 (PIK3CD)
   05213 Endometrial cancer
    101094274 (PIK3CD)
   05224 Breast cancer
    101094274 (PIK3CD)
   05222 Small cell lung cancer
    101094274 (PIK3CD)
   05223 Non-small cell lung cancer
    101094274 (PIK3CD)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101094274 (PIK3CD)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101094274 (PIK3CD)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094274 (PIK3CD)
   04931 Insulin resistance
    101094274 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101094274 (PIK3CD)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    101094274 (PIK3CD)
   05166 HTLV-I infection
    101094274 (PIK3CD)
   05162 Measles
    101094274 (PIK3CD)
   05164 Influenza A
    101094274 (PIK3CD)
   05161 Hepatitis B
    101094274 (PIK3CD)
   05160 Hepatitis C
    101094274 (PIK3CD)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101094274 (PIK3CD)
   05169 Epstein-Barr virus infection
    101094274 (PIK3CD)
   05165 Human papillomavirus infection
    101094274 (PIK3CD)
   05146 Amoebiasis
    101094274 (PIK3CD)
   05142 Chagas disease (American trypanosomiasis)
    101094274 (PIK3CD)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    101094274 (PIK3CD)
   01524 Platinum drug resistance
    101094274 (PIK3CD)
   01522 Endocrine resistance
    101094274 (PIK3CD)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101094274 (PIK3CD)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101094274 (PIK3CD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 101094274
NCBI-ProteinID: XP_006934321
Ensembl: ENSFCAG00000026305
UniProt: M3XAA6
Position
C1
AA seq 1044 aa AA seqDB search
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGA
GTLRVPNRALLVNVKFEGSEESFTFQVSSKDVPLALMACALRKKATVFRQPLLERPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSAPDEKGELLNPAGTVRSNPNTESAAALVICLPEVSP
YPVYYPALDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPDLPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALSNRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMRQGEALSKLKALNDFVKVSSQKTTRPQTKELMHLCMR
QETYLEALSNLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDSSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGPLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gcagttgacttcctgctgcccacgggggtctatctgaacttccctgtgtcccggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgcgcccagtatgagccactcttccac
atgctcagcgaccctgaggcctacgtgttcacctgcgtcaaccagaccgcggagcagcag
gagctggaggacgagcagcggcgactgtgtgacatccagcccttcctgccggtgctgcgc
ctggtggcccgagagggtgacagggtgaagaagcttgtcaactcacagatcagcctcctc
atcggcaaaggcctccacgagttcgactccttgcgggaccccgaggtgaatgactttcgc
accaagatgcgccagttctgcgaggaggcggccgcccgccggcagcagctgggctgggag
gcctggctgcagtacagcttccccctgcagctggagccctcggcccggagctggggggcc
ggcaccctgcgggtccccaaccgggccctcctcgtcaacgtcaagtttgagggcagcgag
gagagcttcaccttccaggtgtccagcaaggatgtgcccctggcactgatggcctgtgcc
ctccggaagaaggccacggtgttccggcagccgctgctggagcggcctgaggactacacc
ctgcaggtgaacgggaagcacgagtacctctacggcagctaccccctctgccagttccag
tacatctgcagctgcttgcacagcgggctgaccccccacctgaccatggtgcactcttct
tccatcctcgccatgcgggatgagcagagcaaccctgccccccaagtccaaaaaccacgc
accaaaccgccccccattcccatgaagaagccttcttccttgtccctgtggtccctggag
cagcctttctgcgtggagctgatccagggtagcaaagtgaatgcggatgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaacgagacgctgtgcaagacggtgtccagc
tcggaggtgagcgtgtgctcagagcccgtgtggaagcagcggctagagtttgacatcaac
gtctgcgacctgcctcgcatggctcgtctctgctttgcactttacgccgtgatcgagaag
gccaagaaggctcggtccaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagaccggtgaatgctgcctgtac
atgtggccgtccgcaccagacgagaagggggagctgctgaaccccgcgggaacagtgcgg
agtaaccccaacacggagagcgctgctgccctagtcatctgcctccctgaggtgtccccc
taccctgtgtactacccggccctggacaagattctggagctggggcggcacggggagcac
gggcgcttcagcgaggaggagcagctgcagctgcgggaaatcctggagcggcgggggtcc
ggggagctgtatgagcacgagaaagacctggtgtggaagatgcggcacgaggtccaggag
cgcttcccggaggcgctggcccgcctgctgctggtcaccaagtggaacaagcacgaggat
gtggcccagatgctctacctgctgtgctcctggccggacctgcccgtcctgagcgccctg
gagctgctggacttcagcttccccgaccgccacgtgggctccttcgccatcaagtctctg
cggaaactgacggacgacgagcttttccagtacctgctgcagctggtgcaggtcctcaag
tacgagtcctacctggactgcgagctgaccaagttcctgctggaccgggccctgtccaac
cgcaagatcggccacttccttttctggcacctccgctccgagatgcacgtgccctccgtg
gcgctgcgcttcggcctcatcatggaagcctactgcaggggcagcacccaccacatgaag
gtgctgatgaggcagggcgaggcgctgagcaaactgaaggccctgaacgactttgtcaag
gtgagctcccagaagaccacccggccccagaccaaagagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctccaacctgcagtccccgctggaccccagcaccctg
ctggccgaagtctgcgtggaacagtgcaccttcatggactccaagatgaagcccctgtgg
gtcatgtacagcaacgaggaggcgggcagtgacagcagtgtgggcatcatctttaagaac
ggggacgacctccgccaggacatgctgactctgcagatgatccagctcatggacgttctg
tggaagcaggagggattggacctgaggatgaccccctatggctgcctctccacgggggac
cgcacaggcctcatcgaggtggtgcttcactcagacaccatcgccaacatccagctgaac
aaaagcaacatggcagccacggctgccttcaacaaggatgccctgctcaactggctcaag
tccaagaaccctggggaagccttggatcgagccattgaggagtttaccctctcctgcgcg
ggttactgtgtggccacttacgtgttgggcatcggtgatcgtcacagtgacaacatcatg
atccgcgagaatgggcagctgttccacattgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgcgtcccattcatcctcacgtacgactttgtgcac
gtgatccagcaggggaaaacgaataacagtgagaaatttgaaaggttccgtggctactgt
gagcgagcctataccatcctgcggcgccacgggcctctgttccttcacctcttcgccctg
atgcgggccgccggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tctctggccttgggaaagacagaggaggaggctctaaagcacttccgagtgaagttcaac
gaagccctccgggagagctggaagaccaaagtgaactggctggcccacaacgtgtccaaa
gacaacaggcagtag

DBGET integrated database retrieval system