KEGG   Felis catus (domestic cat): 101094304Help
Entry
101094304         CDS       T02385                                 

Gene name
ALOX12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S-type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
fca  Felis catus (domestic cat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101094304 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    101094304 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101094304 (ALOX12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    101094304 (ALOX12)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     101094304 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
E1
AA seq 678 aa AA seqDB search
PARPRPPGPAPRRCPERGTRAALSGGLGQRGLRKGAPDPHEDGLSRAPAPKCRGLWPPQE
EEFEREVPKDLGPLQFVKLRKHHSLVDDAWFCDCITVRGPGACEEATFFPCYRWVQGQDV
LSLPEGTARLAGDNALDVFQKHREKELKERRRLYCWATWKEGLPRTIAAERQDDLPPNSR
FHEEKRLDFEWALKAGALEMVLKRVYTLLSSWSRLEDFDQIFWGQKSDLAERVHHCWRDD
ELFGYQFLNGANPMVLRRSASLPSRLVLPSGTEALGAQLERELQSGSLFEADFSLLDGIP
ANVIRGEKQYLAAPLVMLQMRPEGKLLPVVIQIQPPSPSCPAPPLFLPSDPPLAWLLAKI
WVRNSDFQLHQLQYHLLNTHLVAEVIAVATMRCLPGLHPVFKLLIPHIRYTLEINTRARS
QLISEGGIFDKAVSTGGGGHVHLLRRAMAQLTYSSLCPPDDLAARGLLGIPSALYAHDAL
RLWEIIARYVQGIVRLFYHRDDIVRGDPELQAWCREITEVGLCQAQDRGFPASFQSQSQL
CHFLTMCVFTCTAQHGAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVKMATVMGSLPDIR
QACLQMTITWHLGRRQPDMVPLGHHKEKYFSSPKAKAVLSQFQTDLENLEREITARNAQV
DLPYDYLRPSRIENSVTI
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
cccgcgcgccctcgtcctcccgggcccgcgccgcgcaggtgtccggagaggggaacaagg
gctgccctctctggaggccttgggcagcgggggctccgcaaaggcgcccccgacccccac
gaagacggcctctcccgggcccctgctcctaagtgtcgcggactgtggcccccgcaggag
gaggagttcgagcgcgaagtccccaaggacctggggcccctgcagttcgtgaagctgcgc
aaacaccactcgctggtggacgacgcttggttctgcgactgcatcaccgtgcgcggcccc
ggagcctgcgaggaggccaccttcttcccctgctaccgctgggtgcaaggccaggacgtg
ctgagcctgcccgagggcaccgcgcgcctggcaggagacaatgccttggacgtgttccag
aagcatcgggagaaagagctgaaggagagacgaagactgtactgctgggccacctggaag
gaagggttaccccggacgatagcggcagaacgccaggacgatctgcctccaaactcgagg
ttccatgaggaaaagaggctggacttcgagtgggcgctgaaggcaggggctctggagatg
gtcctcaagcgcgtttacaccctcctgagctcctggagccgcctggaggattttgaccag
atcttctggggccagaagagcgacctggctgagagggttcaccactgctggcgggacgat
gaacttttcggctaccagttcctcaacggcgccaaccccatggtgctgagacgctccgcc
tccctgccctctcggctggtgctgccctcggggaccgaggcgctgggggcccagctggag
agagaactccagagcggttccctgtttgaggctgacttcagcctgctggacggaatcccg
gccaacgtgatccgaggagagaagcagtacctggccgcccccctcgtgatgctccagatg
cggcccgaggggaagctgctgcccgtggtcatccagatccagccccccagccccagctgc
cccgcgcccccgctgttcctgccctcggatcccccgctcgcctggctcctggcaaagatc
tgggtccgcaattccgatttccaactgcaccagctccagtatcatctgctcaacactcac
ctggtggccgaggtcatcgccgtggccaccatgaggtgcctcccagggctgcaccccgtc
ttcaagctcctgatcccgcacatccgctataccttggaaatcaacacccgggccagatcc
cagctcatctcggaaggaggaatatttgataaggcggtgagcactggcggagggggccac
gtgcacttgctccgtcgggccatggcccagctgacctacagctccctctgtcctcctgac
gacctggctgcgcggggcctgctgggaatcccaagtgccctctacgcccacgacgcccta
cggctctgggagatcattgcccggtacgtgcagggcatcgtccgccttttctaccacagg
gacgacatcgtgagaggggaccctgagctgcaggcctggtgccgggagatcaccgaggtg
gggctgtgccaggcccaggaccgaggtttccccgcctccttccagtcccagagtcagctc
tgtcatttccttacgatgtgcgtcttcacttgcactgcccagcacggggccatcaaccag
ggccagctggactggtacgcctgggtccctaacgccccgtgcaccatgcggatgccccca
cccacgaccaaggaagacgtgaagatggccacagtgatgggctcactacctgacatccga
caggcctgtcttcaaatgaccatcacgtggcacctgggtcgccgccagccagacatggta
cctctggggcaccacaaagaaaagtatttctcaagccccaaggccaaggctgtactaagc
caattccaaacagatctggaaaacttagaaagagagatcacagcccggaatgcacaagtg
gacctgccctacgactacctgaggcccagccgcatagagaacagtgttaccatctga

DBGET integrated database retrieval system