KEGG   Felis catus (domestic cat): 101094304Help
Entry
101094304         CDS       T02385                                 

Gene name
ALOX12
Definition
arachidonate 12-lipoxygenase
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
fca  Felis catus (domestic cat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101094304 (ALOX12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    101094304 (ALOX12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101094304 (ALOX12)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     101094304 (ALOX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 686 aa AA seqDB search
SLTPRGPCPARPRPPGPAPRRCPERGTRAALSGGLGQRGLRKGAPDPHEDGLSRAPAPKC
RGLWPPQEEEFEREVPKDLGPLQFVKLRKHHSLVDDAWFCDCITVRGPGACEEATFFPCY
RWVQGQDVLSLPEGTARLAGDNALDVFQKHREKELKERRRLYCWATWKEGLPRTIAAERQ
DDLPPNSRFHEEKRLDFEWALKAGALEMVLKRVYTLLSSWSRLEDFDQIFWGQKSDLAER
VHHCWRDDELFGYQFLNGANPMVLRRSASLPSRLVLPSGTEALGAQLERELQSGSLFEAD
FSLLDGIPANVIRGEKQYLAAPLVMLQMRPEGKLLPVVIQIQPPSPSCPAPPLFLPSDPP
LAWLLAKIWVRNSDFQLHQLQYHLLNTHLVAEVIAVATMRCLPGLHPVFKLLIPHIRYTL
EINTRARSQLISEGGIFDKAVSTGGGGHVHLLRRAMAQLTYSSLCPPDDLAARGLLGIPS
ALYAHDALRLWEIIARYVQGIVRLFYHRDDIVRGDPELQAWCREITEVGLCQAQDRGFPA
SFQSQSQLCHFLTMCVFTCTAQHGAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVKMATV
MGSLPDIRQACLQMTITWHLGRRQPDMVPLGHHKEKYFSSPKAKAVLSQFQTDLENLERE
ITARNAQVDLPYDYLRPSRIENSVTI
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
tcgctgaccccgcgcgggccgtgccccgcgcgccctcgtcctcccgggcccgcgccgcgc
aggtgtccggagaggggaacaagggctgccctctctggaggccttgggcagcgggggctc
cgcaaaggcgcccccgacccccacgaagacggcctctcccgggcccctgctcctaagtgt
cgcggactgtggcccccgcaggaggaggagttcgagcgcgaagtccccaaggacctgggg
cccctgcagttcgtgaagctgcgcaaacaccactcgctggtggacgacgcttggttctgc
gactgcatcaccgtgcgcggccccggagcctgcgaggaggccaccttcttcccctgctac
cgctgggtgcaaggccaggacgtgctgagcctgcccgagggcaccgcgcgcctggcagga
gacaatgccttggacgtgttccagaagcatcgggagaaagagctgaaggagagacgaaga
ctgtactgctgggccacctggaaggaagggttaccccggacgatagcggcagaacgccag
gacgatctgcctccaaactcgaggttccatgaggaaaagaggctggacttcgagtgggcg
ctgaaggcaggggctctggagatggtcctcaagcgcgtttacaccctcctgagctcctgg
agccgcctggaggattttgaccagatcttctggggccagaagagcgacctggctgagagg
gttcaccactgctggcgggacgatgaacttttcggctaccagttcctcaacggcgccaac
cccatggtgctgagacgctccgcctccctgccctctcggctggtgctgccctcggggacc
gaggcgctgggggcccagctggagagagaactccagagcggttccctgtttgaggctgac
ttcagcctgctggacggaatcccggccaacgtgatccgaggagagaagcagtacctggcc
gcccccctcgtgatgctccagatgcggcccgaggggaagctgctgcccgtggtcatccag
atccagccccccagccccagctgccccgcgcccccgctgttcctgccctcggatcccccg
ctcgcctggctcctggcaaagatctgggtccgcaattccgatttccaactgcaccagctc
cagtatcatctgctcaacactcacctggtggccgaggtcatcgccgtggccaccatgagg
tgcctcccagggctgcaccccgtcttcaagctcctgatcccgcacatccgctataccttg
gaaatcaacacccgggccagatcccagctcatctcggaaggaggaatatttgataaggcg
gtgagcactggcggagggggccacgtgcacttgctccgtcgggccatggcccagctgacc
tacagctccctctgtcctcctgacgacctggctgcgcggggcctgctgggaatcccaagt
gccctctacgcccacgacgccctacggctctgggagatcattgcccggtacgtgcagggc
atcgtccgccttttctaccacagggacgacatcgtgagaggggaccctgagctgcaggcc
tggtgccgggagatcaccgaggtggggctgtgccaggcccaggaccgaggtttccccgcc
tccttccagtcccagagtcagctctgtcatttccttacgatgtgcgtcttcacttgcact
gcccagcacggggccatcaaccagggccagctggactggtacgcctgggtccctaacgcc
ccgtgcaccatgcggatgcccccacccacgaccaaggaagacgtgaagatggccacagtg
atgggctcactacctgacatccgacaggcctgtcttcaaatgaccatcacgtggcacctg
ggtcgccgccagccagacatggtacctctggggcaccacaaagaaaagtatttctcaagc
cccaaggccaaggctgtactaagccaattccaaacagatctggaaaacttagaaagagag
atcacagcccggaatgcacaagtggacctgccctacgactacctgaggcccagccgcata
gagaacagtgttaccatctga

DBGET integrated database retrieval system