KEGG   Felis catus (domestic cat): 101094338Help
Entry
101094338         CDS       T02385                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fca  Felis catus (domestic cat)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101094338 (RBKS)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101094338 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A3
AA seq 322 aa AA seqDB search
MAASGEPGRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCV
QAARLGAKTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTQDAATGTASIIVNNEGQNI
IIIVAGANLLLNTEDLREAAKAISRAKVMICQLEVTPETSLEALTMAHSNGVKTLFNPAP
AIADLDPRFYALSDVFCCNETEAEILTGLTVSSPADAGKAAQVLLERGCQVVIITLGAEG
CVMLSQTEPVPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEEMLKRANFIAAV
SVQAAGTQSSYPYKKDLPLDLF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtctggggaacccggccggcagtggcaggaggaggtggcggcggtggtagtg
gtgggctcctgcatgaccgacctggtcagccttacttctcgtttgcccaaaactggtgaa
accattcatggacataagttttttattggctttggagggaaaggtgccaaccagtgtgtc
caagctgctaggctcggagcaaagacatccatggtatgcaaggttggcaaagattctttt
ggcaatgattatatagaaaacttaaaacagaatgatatttctacagaatttacatatcag
actcaagatgctgctacaggaactgcttctataattgtcaataatgaaggccagaatatc
atcataatagtggccggagcgaatttacttttgaatactgaagacctgagggaagcagcc
aaggccatcagcagagccaaagtaatgatctgccagctagaagtaactccggaaacttct
ttggaagccctgaccatggcccacagcaatggagtgaaaacattgttcaatccagctcct
gccattgctgacctggatcctcgcttctacgccctctcagatgtgttctgctgcaatgaa
actgaggctgagatcctaactggcctcacggtcagcagccctgcagacgctgggaaggct
gcacaggtgctcttggaaagggggtgccaggtcgtaatcatcaccttaggtgctgaaggc
tgtgtgatgctgtcacagacagaacctgtcccaaagcacatccccacagagaaggtcaag
gctgtggataccacgggtgctggtgacagttttgtgggggctctggccttctacctggct
tactaccccaatctgtccttggaagaaatgctcaagagagccaatttcatcgcagcagtc
agcgtccaggctgcaggaacacagtcatcttatccatacaaaaaagacctgccacttgat
ctgttttga

DBGET integrated database retrieval system