KEGG   Felis catus (domestic cat): 101094450Help
Entry
101094450         CDS       T02385                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl releasing protein 2 (calcium and DAG-regulated)
  KO
K12361  
RAS guanyl-releasing protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101094450 (RASGRP2)
   04015 Rap1 signaling pathway
    101094450 (RASGRP2)
   04010 MAPK signaling pathway
    101094450 (RASGRP2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101094450 (RASGRP2)
   04062 Chemokine signaling pathway
    101094450 (RASGRP2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101094450 (RASGRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D1
AA seq 418 aa AA seqDB search
MGCPSAESFLSTNPLPPRQKSWAKFWASSVTDYLRPSSFAPQKLLQLQNFNTLMAVVGGL
SHSSISRLKETHSHVSPETVKLWEGLTELVTATGNYGNYRRRLAACVGFRFPILGVHLKD
LVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQ
YQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLDEWTSAAKPRLDQALLVEHIEKM
VESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSV
LGGRMGFVHNFHESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCRDRLSVECRR
RAQSVSLEGPAPSPSPTHTHHRAFSFSLPRPGRRGSRPPEIREEEVQAVEDGVFDIHL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcccatcggcggagtccttcctttccaccaacccactgcctcctcgccagaaa
agctgggccaagttctgggcctcttcagtgactgactacctacgcccctcctcctttgcc
ccccagaagctcctgcagctgcagaacttcaacacgctaatggcagtggtcggaggcctg
agccacagttccatctcgcgcctcaaggagacccacagtcatgttagccctgagacggtc
aagctctgggaaggtctcacggaactggtgacagccacagggaactatggcaactacaga
cgccggctggcagcctgcgtgggcttccgctttcccatcctgggcgtgcacctcaaggac
ctggtggccctgcagctggcactgcctgactggctggaccccgcccggacccgacttaat
ggggccaagatgaaacagctcttcagcatcctggaggagctggccatggtgaccagcctt
cggccaccagtgcaggccaacccagatctgctgagcctactcacggtgtctctggatcag
tatcagacggaggatgaactctaccagctgtccctgcagcgggagccgcgctcgaagtcc
tcgccaaccagccccacaagctgcaccccacctccccggcccccggtgctggatgagtgg
acctcagccgccaaacccaggctagatcaagcactcctagtggaacacatcgagaagatg
gtggagtctgtgttccggaactttgacgtcgatggggacggccacatctcacaggaagag
ttccagatcatccgtgggaacttcccttacctcagcgcctttggggacctcgaccagaac
caggatggctgcatcagcagggaggaaatggtgtcctacttcctgcgctccagctcggtg
ctgggcggccgcatgggcttcgtgcacaacttccacgagagcaactccttgcgccccgtt
gcctgccgccactgcaaggccctgatcctgggcatctacaagcagggcctcaaatgccga
gcctgcggtgtgaactgccacaagcaatgtagagaccgtctgtccgttgagtgccggcgc
cgggcccagagcgtgagtctggaggggcctgcgccctcgccctcgcccacacacacccat
caccgggccttcagcttctccctgccccgcccaggtaggcgaggctcccggcctccagag
atcagagaggaggaggtgcaggccgtggaggatggcgtatttgacatccacttgtaa

DBGET integrated database retrieval system