KEGG   Felis catus (domestic cat): 101094450Help
Entry
101094450         CDS       T02385                                 

Gene name
RASGRP2
Definition
RAS guanyl releasing protein 2 (calcium and DAG-regulated)
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:fca04014]
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:fca04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:fca04010]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:fca04062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D1
AA seq 645 aa AA seqDB search
MRSLRGRGTPGWPGSSELQVQNXAPSTGLHSGLESWVCVPEGSFLQVCTGLPAPAAMAGT
LDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIYQQSR
KDNSNSLQVKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESV
PTYKWKRQVTQRNPVGQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHSFVTH
GCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNFNTLM
AVVGGLSHSSISRLKETHSHVSPETVKXXXXXXXXFRFPILGVHLKDLVALQLALPDWLD
PARTRLNGAKMKQLFSILEELAMVTSLRPPVQANPDLLSLLTVSLDQYQTEDELYQLSLQ
REPRSKSSPTSPTSCTPPPRPPVLDEWTSAAKPRLDQALLVEHIEKMVESVFRNFDVDGD
GHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEMVSYFLRSSSVLGGRMGFVHNFHE
SNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQCRDRLSVECRRRAQSVSLEGPAPS
PSPTHTHHRAFSFSLPRPGRRGSRPPEIREEEVQAVEDGVFDIHL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcctccgtggccgcgggactccaggctggcctggctcgagcgagctgcaagtc
cagaacntggccccatcaacgggtttgcattctgggctagaaagctgggtatgtgtgccc
gagggatccttcctgcaggtgtgcacgggcctccccgcgccggcggccatggcgggcacc
ctagacctggacaagggctgcacggtggaggagctgctccgcggctgcatcgaagccttc
gatgactccgggaaggtgcgagacccgcagctggtgcgcatgttcctcatgatgcaccct
tggtacatcccttcttcgcagctggcggcaaaactgctccacatctaccaacaatcccgg
aaggacaactccaattcgctgcaggtgaaaacatgccacctggtcaggtactggatctcg
gcattcccagcagagtttgacttgaaccctgagctcgctgagcagatcaaggagctgaag
gctctgttagaccaagaagggaaccggcggcacagcagcctcattgacatcgagagtgtc
cccacctacaagtggaagcggcaggtgacccagcggaaccccgtaggacagaaaaagcga
aagatgtccctgttgttcgaccacctggagcccatggagctggcggagcatctcacctac
ttggagtatcgctccttctgcaagatcctgttccaggactatcacagttttgtgactcac
ggctgcaccgtggacaaccccgtcctggagcgattcatctccctcttcaacagtgtgtcg
cagtgggtgcaactcatgatcctcagcaagcccacagcccctcagcgggccctggtcatc
acacacttcgtccacgtggcagagaagctcctgcagctgcagaacttcaacacgctaatg
gcagtggtcggaggcctgagccacagttccatctcgcgcctcaaggagacccacagtcat
gttagccctgagacggtcaagnnnnnnnnnnnnnnnnnnnnnnncttccgctttcccatc
ctgggcgtgcacctcaaggacctggtggccctgcagctggcactgcctgactggctggac
cccgcccggacccgacttaatggggccaagatgaaacagctcttcagcatcctggaggag
ctggccatggtgaccagccttcggccaccagtgcaggccaacccagatctgctgagccta
ctcacggtgtctctggatcagtatcagacggaggatgaactctaccagctgtccctgcag
cgggagccgcgctcgaagtcctcgccaaccagccccacaagctgcaccccacctccccgg
cccccggtgctggatgagtggacctcagccgccaaacccaggctagatcaagcactccta
gtggaacacatcgagaagatggtggagtctgtgttccggaactttgacgtcgatggggac
ggccacatctcacaggaagagttccagatcatccgtgggaacttcccttacctcagcgcc
tttggggacctcgaccagaaccaggatggctgcatcagcagggaggaaatggtgtcctac
ttcctgcgctccagctcggtgctgggcggccgcatgggcttcgtgcacaacttccacgag
agcaactccttgcgccccgttgcctgccgccactgcaaggccctgatcctgggcatctac
aagcagggcctcaaatgccgagcctgcggtgtgaactgccacaagcaatgtagagaccgt
ctgtccgttgagtgccggcgccgggcccagagcgtgagtctggaggggcctgcgccctcg
ccctcgcccacacacacccatcaccgggccttcagcttctccctgccccgcccaggtagg
cgaggctcccggcctccagagatcagagaggaggaggtgcaggccgtggaggatggcgta
tttgacatccacttgtaa

DBGET integrated database retrieval system