KEGG   Felis catus (domestic cat): 101094471Help
Entry
101094471         CDS       T02385                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein isoform X1
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04110  Cell cycle
fca04310  Wnt signaling pathway
fca04330  Notch signaling pathway
fca04350  TGF-beta signaling pathway
fca04520  Adherens junction
fca04630  Jak-STAT signaling pathway
fca04720  Long-term potentiation
fca04916  Melanogenesis
fca04919  Thyroid hormone signaling pathway
fca04922  Glucagon signaling pathway
fca05016  Huntington's disease
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  HTLV-I infection
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05168  Herpes simplex infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05206  MicroRNAs in cancer
fca05211  Renal cell carcinoma
fca05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101094471 (CREBBP)
   04330 Notch signaling pathway
    101094471 (CREBBP)
   04350 TGF-beta signaling pathway
    101094471 (CREBBP)
   04630 Jak-STAT signaling pathway
    101094471 (CREBBP)
   04066 HIF-1 signaling pathway
    101094471 (CREBBP)
   04068 FoxO signaling pathway
    101094471 (CREBBP)
   04024 cAMP signaling pathway
    101094471 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101094471 (CREBBP)
  Cellular community - eukaryotes
   04520 Adherens junction
    101094471 (CREBBP)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    101094471 (CREBBP)
   04919 Thyroid hormone signaling pathway
    101094471 (CREBBP)
   04916 Melanogenesis
    101094471 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    101094471 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101094471 (CREBBP)
   05206 MicroRNAs in cancer
    101094471 (CREBBP)
   05203 Viral carcinogenesis
    101094471 (CREBBP)
   05211 Renal cell carcinoma
    101094471 (CREBBP)
   05215 Prostate cancer
    101094471 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    101094471 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    101094471 (CREBBP)
   05166 HTLV-I infection
    101094471 (CREBBP)
   05164 Influenza A
    101094471 (CREBBP)
   05161 Hepatitis B
    101094471 (CREBBP)
   05168 Herpes simplex infection
    101094471 (CREBBP)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101094471 (CREBBP)
   05169 Epstein-Barr virus infection
    101094471 (CREBBP)
   05165 Human papillomavirus infection
    101094471 (CREBBP)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101094471 (CREBBP)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101094471 (CREBBP)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101094471 (CREBBP)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101094471 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Motif
Other DBs
NCBI-GeneID: 101094471
NCBI-ProteinID: XP_023102362
Ensembl: ENSFCAG00000006262
Position
E3
AA seq 2454 aa AA seqDB search
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELGLINSGNLV
PDAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPALLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGASSSVLA
ETLTQVSPQMASHAGLNTAQAGGMTKMGMAGNTSPFGQPFSQTGGQQMGAPGVNPQLSSK
QSMVNSLPPFPTDIKNPSVTNVPNMSQMQTSVGIVPTQAITAGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQSHQQMRTLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSGSANLGTLSTIPTAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQG
MNSFTPMSLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHS
NNIMAQAPAQNQFLPQNQFQSSGGAMSVSSVGLGQPAAQTGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQSPLHQTPPPASTAAGMPSLQHPSAPGMTPPQPAAPTQPSTPVSSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPP
GTPLSQAAASIDNRVPTPSSVASAETNSQQPGPEAPMLEMKAEVKTEDTEPDASESKGEP
GSAMMEEDLQGSSQVKEETDTTEQKSEPMEVDEKKPEVKVETKEEEESSANGAASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGLLADRYHFCEKCFTEIQGE
NVTLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFV
CDNCLKKTGRTRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDK
TVEVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTR
RVYISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCH
PPDQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPN
VLEESIKELEQEEEERKKEESSAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKK
PSMPNVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAF
LTLARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYD
LCINCYNTKSHAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRN
ANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIK
HKLRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPA
QPQPSPVSMSPAGFPGVARTQPPTTVSAGKPANQVPAPPPPAQPPPAAVEAARQIEREAQ
QQQHLYRVNINNGVPPGRTGMVTPVGQMAPAGLNVPRPGPVSGPVVPNLPPGQWQQAPLP
QQQPMPGMPRPVMSMQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVL
NILKSNPQLMAAFIKQRTAKYVASQPGLQPQPGLQPQPGLQPQPGLQPQQPGLQNLNAMQ
AGGPRPGVPPQQQAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMLRRQLLQQQQQQQQ
QPPPPPPPQGGAGMAGGMAGHGQFQQPQGPGGYPPAMQQQRMQQHLPIQGSSMGQMAAQM
GQLGQMGQPGLGADGTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQAS
HLPGQQMATSLSSQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLA
VTMASSIDQGHLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7365 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggaggagaattaggccttataaacagtgggaaccttgtt
ccagatgctgcttccaaacataaacaactgtcggagcttctgcgcggaggcagcggctct
agtatcaacccaggaataggaaatgttagcgccagcagccccgtgcagcaaggcctcggt
gggcaggctcaagggcagccgaacagtgcaaacatggccagcctgggtgccatgggcaag
agccctctgaaccagggagattcttcagcccccagcctgcccaaacaggcagccagcacc
tctgggcccactccccctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtgaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaatgctaac
tttaaccagacccaccctgccctcctcaatagtaactctggccatagtttaatgaaccag
gcccagcaaggacaggcgcaagtcatgaatggctctcttggggcggccggcagaggaagg
ggagctgggatgccgtaccccgcgcccgccatgcagggggcctcgagcagcgtgttggcc
gagacgttaacgcaggtctcgccgcaaatggccagtcacgcgggactgaacacggcgcag
gcaggaggcatgaccaagatgggaatggctggtaacacaagtccatttggacaacccttt
agtcaaactggagggcagcaaatgggagcccctggagtgaacccccagttatccagcaaa
cagagcatggtcaatagtttgcctcccttccctacagacatcaagaatccttccgtcacc
aacgtgccaaacatgtctcagatgcaaacttcagtgggaattgtacccacacaagcgatc
acagcaggccccactgcagatcctgaaaagcgcaaactgatacagcagcagctggttcta
ctgcttcatgctcacaagtgtcagagacgagaacaagcgaacggagaagttcgggcctgc
tctctcccgcattgccgaaccatgaagaatgttttgaatcacatgacacactgtcaggct
gggaaagcctgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtgggattcagaacacgatcggttctgtc
ggcaccggccagcagaacgccgcttcgctgagtaacccgaatcccatagaccccagctcc
atgcagcgcgcgtatgctgcccttggtctcccctacctgaaccagccccagacgcagctg
cagcctcaggttcccggccagcaaccagcacagcctcaaagtcaccagcagatgaggact
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccgccaaacttgatttcagaatcagctcttccaacttccctcggggccacaaaccca
ctgatgaacgatggctcaggctctgcaaacctcgggaccctcagcactatacccacagcg
gcacctccttccagcaccggcgtgcggaaaagctggcacgaacatgtcactcaggacctg
cggagccacctagtgcataaactggtccaagccatcttcccaacccctgacccggcagcc
ctgaaggatcgccgcatggagaacctggtggcctatgctaagaaagtggagggggacatg
tatgagtccgccaacagcagggatgaatactatcacttactggcagaaaaaatttacaag
atacaaaaagaactagaagaaaagcggaggtcacgtttacacaaacaaggcatcctgggt
aaccagcccgccctaccagcccccggggcacagccccctgggattccgcaggcacaacct
gtgaggcctccaaatggacccatgcccctgccagtgaatcgcgtgcaggtttctcaaggg
atgaattcatttaccccaatgtccttggggaacgtacagttgccgcaggctcccatggga
ccgcgtgcagcgtcccccatgaaccactctgtcccgatgaacagcatgggctccgttcca
gggatggccatttctccttcccgaatgccccagcctccgaacatgatgggcgctcacagc
aacaacatcatggcccaggcgcctgcgcagaaccagttcctgcctcagaaccagttccag
tcctccggcggggcgatgagtgtgagcagcgtgggcctgggccagccggcggcccagacg
ggcgtgccgcagggacaggtgcctggtgctgctcttcctaaccctctgaacatgcttggg
cctcaggccagccagctgccttgtccaccagtgacacagtcaccgttgcaccagacgcca
ccccctgcttccacggccgcgggcatgccgtctctccagcacccgtcggcgcctgggatg
actcctccccagccagcagctcccacccagccatcgactcctgtgtcgtcttccgggcag
acccctaccccgactcccggctcggtgcccagtgccagccagacccagagcaccccgacg
gtccaggcagcagcccaggcccaggtgaccccacagcctcagaccccagtccagcccccg
tctgtggccacccctcagtcatcacaacagcagccgacgcctgtgcatgcccagcctccc
ggcacaccgctttcccaggcagcagccagcatcgataaccgggtccccactccttcctcg
gtggccagcgccgaaaccaactcccagcagccaggacccgaggcaccgatgctggagatg
aaagcagaggtcaagactgaggacactgagcctgatgccagtgaatccaagggggagccg
gggtctgcgatgatggaggaggatctgcaaggatcttctcaagttaaagaagaaacagac
acaacagaacagaaatccgaaccgatggaagtggacgagaagaaaccggaagtcaaagta
gaaactaaagaggaagaagagagcagcgctaatggggccgcctctcagtcaacatctcct
tcacagccacgcaaaaaaatctttaagccggaagagttacgccaggctctgatgccaacc
ctggaagcgctgtaccgccaggacccggagtccttgcctttccggcagcctgtggacccc
cagctgctagggatcccggattattttgacattgtcaagaaccctatggacctttccacc
atcaagcggaagctggacacggggcagtaccaagaaccctggcagtatgtggatgacgtc
tggctcatgttcaacaacgcctggctctataaccggaagacgtcccgggtctataagttc
tgcagcaaacttgctgaggtctttgagcaggaaattgaccccgtcatgcagtcccttgga
tattgttgtgggcgcaagtatgagttttccccacagactttgtgctgctatgggaagcag
ctgtgtacaattcctcgcgacgctgcctactacagctatcagaacagttcacccaagtat
ggccttcttgctgacaggtatcatttctgtgagaagtgtttcacagagatccagggggag
aatgttaccctgggtgacgacccttcacaaccccagacgacaatttcaaaggatcagttt
gaaaagaagaaaaatgataccttagatcctgaaccttttgtcgattgcaaggagtgtggc
cggaagatgcatcagatttgtgttctgcactatgacatcatttggccttcgggcttcgtg
tgtgacaattgcctgaagaaaaccggcagaactcggaaagaaaacaagttcagtgcgaag
agactacagaccacgcgattgggcaaccacttggaagaccgagtcaacaagtttttgcgg
cgacagaatcatcccgaagccggggaggtctttgtccgggtggtggccagctcagacaag
actgtggaggtcaagcctgggatgaagtcacggtttgtggattccggggaaatgtctgaa
tctttcccgtatcgaaccaaagcactctttgcttttgaggaaattgacggagtggatgtg
tgcttctttggaatgcacgtgcaagagtacggctccgattgcccccctccaaacacaagg
cgtgtatacatatcttatctggacagtattcatttcttccggccccggtgcctccggacc
gctgtttaccatgagatccttattggatatttagaatacgtgaagaaattggggtacgta
acgggacacatctgggcctgccccccgagtgaaggagatgactatatcttccattgccac
ccccctgatcagaaaatccccaaaccaaagcgcctgcaggagtggtacaagaagatgctg
gacaaggcatttgcagaacggatcattcacgactacaaggacattttcaaacaagcgacc
gaagacaggctcaccagtgccaaggagctgccctattttgagggtgacttctggcccaat
gtgctggaggagagcattaaggagttggagcaagaagaagaagagaggaagaaggaggag
agcagtgcagccagcgagaccacggagggcagccagggtgacagcaagaatgccaagaag
aagaacaacaagaaaaccaataagaataaaagcagcatcagtcgagccaacaaaaagaag
cccagcatgcccaacgtgtccaacgacttgtcccagaagctctacgccaccatggagaag
cacaaagaggtcttctttgtgattcacctgcacgccgggcccgtcatcaacacactgccc
cccatcgtcgaccctgaccccctgctcagctgtgacctcatggacgggcgtgacgccttc
ctcacccttgccagagacaagcactgggagttctcgtccctgcgccggtccaagtggtcc
acgctgtgcatgctggtggagctgcacacacagggccaggaccggtttgtctacacctgc
aacgagtgcaagcaccacgtggagacgcgctggcactgcaccgtgtgcgaggactacgac
ctgtgcatcaactgctacaacacgaagagccacgcccacaagatggtgaagtgggggctg
ggcctggacgacgagggcagcagccagggcgagccgcagtccaagagcccccaggagtcg
cggcgcctgagcatccagcgctgcatccagtccctggtgcacgcctgccagtgccgcaac
gccaactgctcgctgccgtcctgccagaagatgaagcgggtggtgcagcacaccaagggc
tgcaagcgcaagaccaacgggggctgcccggtgtgcaagcagctcatcgccctctgctgc
taccacgccaaacactgccaggagaacaaatgcccggtgcccttctgcctcaacatcaaa
cacaagctccgccagcagcagatccagcaccgcctgcagcaggctcagctcatgcgccgg
cggatggccaccatgaacacccgcaacgtgcctcagcagagtctgccttcccctacctca
gcgccgcccgggacccccacgcagcagcccagcacgccccagacgccgcagccacccgcc
cagccccagccctcgcccgtgagcatgtcaccggccggcttccccggcgtggcccggact
cagccccccaccacggtgtccgccgggaagcccgccaaccaggtgccggccccgccgccc
cccgcccagcccccgccggccgcggtggaagcggcccggcagatcgagcgcgaggcgcag
cagcagcagcacctgtaccgggtgaacatcaacaacggcgtgcccccggggcgcacgggc
atggtgaccccggtgggccagatggcccccgcgggcctgaacgtgccccggcccggcccg
gtcagcgggcccgtcgtgcccaacctgccgcccgggcagtggcagcaggcgcctctcccc
cagcagcagccgatgccgggcatgcccaggcccgtgatgtccatgcaggcccagccggcc
gtggcagggcctcggatgcccagcgtgcagccgccccggagcatctcgcccggcgccctg
caggacctgttgcggaccctgaagtcgcccagctccccgcagcagcagcagcaggtgctc
aacatcctcaagtcaaacccccagctgatggcggctttcatcaagcagcgcacggccaag
tacgtggccagtcagcccggcctccagccccagcccggcctccagccccagcccggcctc
cagccccagcccggcctccagccccagcagcccggcctgcagaacctgaacgccatgcaa
gccggcgggccccggcccggcgtgcccccgcagcagcaggcgatgggaggcctgaacccc
cagggccaggccctgaacatcatgaacccggggcacaaccccagcatggcgagcatgaac
ccgcagtacagagagatgctgcgccggcagctgctgcagcagcagcaacagcagcagcag
cagccgccgccgccgccaccgccacagggcggcgcgggcatggcggggggcatggccggg
cacggccagttccagcagccccagggacccggaggctacccgccggccatgcagcagcag
cggatgcagcagcacctccccatccagggcagctccatgggccagatggcggctcagatg
ggacagctcggccagatggggcagcccgggctgggcgcggacggcacccccaacatccag
caggccctgcagcagcggattctgcagcagcagcagatgaagcagcagatcgggtccccg
ggccagccgaaccccatgagcccccagcagcacatgctctcaggacagccccaggcctcg
cacctcccgggccagcagatggccacgtccctcagtagccaggtgcggtccccggcccct
gtccagtctccgcggccccagtcccagcctccacattccagcccgtcgccacggatccag
ccccagccttcgccgcaccacgtctcgccccagaccggttccccccacccaggactcgcg
gtcaccatggccagctccatagatcagggacacttggggaaccccgaacagagtgcaatg
ctcccccagctgaacacccccaacaggagtgcgttgtccagtgagctgtccctggtcggc
gacaccacaggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system