KEGG   Felis catus (domestic cat): 101094471Help
Entry
101094471         CDS       T02385                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Glucagon signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
Human papillomavirus infection
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101094471 (CREBBP)
   04330 Notch signaling pathway
    101094471 (CREBBP)
   04350 TGF-beta signaling pathway
    101094471 (CREBBP)
   04630 Jak-STAT signaling pathway
    101094471 (CREBBP)
   04066 HIF-1 signaling pathway
    101094471 (CREBBP)
   04068 FoxO signaling pathway
    101094471 (CREBBP)
   04024 cAMP signaling pathway
    101094471 (CREBBP)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101094471 (CREBBP)
  Cellular community - eukaryotes
   04520 Adherens junction
    101094471 (CREBBP)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    101094471 (CREBBP)
   04919 Thyroid hormone signaling pathway
    101094471 (CREBBP)
   04916 Melanogenesis
    101094471 (CREBBP)
  Nervous system
   04720 Long-term potentiation
    101094471 (CREBBP)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101094471 (CREBBP)
   05206 MicroRNAs in cancer
    101094471 (CREBBP)
   05203 Viral carcinogenesis
    101094471 (CREBBP)
   05211 Renal cell carcinoma
    101094471 (CREBBP)
   05215 Prostate cancer
    101094471 (CREBBP)
  Neurodegenerative diseases
   05016 Huntington's disease
    101094471 (CREBBP)
  Infectious diseases
   05152 Tuberculosis
    101094471 (CREBBP)
   05166 HTLV-I infection
    101094471 (CREBBP)
   05164 Influenza A
    101094471 (CREBBP)
   05161 Hepatitis B
    101094471 (CREBBP)
   05168 Herpes simplex infection
    101094471 (CREBBP)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101094471 (CREBBP)
   05169 Epstein-Barr virus infection
    101094471 (CREBBP)
   05165 Human papillomavirus infection
    101094471 (CREBBP)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101094471 (CREBBP)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101094471 (CREBBP)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101094471 (CREBBP)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101094471 (CREBBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
E3
AA seq 2204 aa AA seqDB search
MTGGVCRVTEKSPARAFEDFGSLFDLENDLPDELIPNGGELGLINSGNLVPDAASKHKQL
SELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSANMASLGAMGKSPLNQGDSSA
PSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANFNQTHPALLN
SNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGASSSVLAETLTQVSPQM
ASHAGLNTAQAGGMTKMGMAGNTSPFGQPFSQTGGQQMGAPGVNPQLSSKQSMVNSLPPF
PTDIKNPSVTNVPNMSQMQTSVGIVPTQAITAGPTADPEKRKLIQQQLVLLLHAHKCQRR
EQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKNCTRHDCPVC
LPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNAASLSNPNPIDPSSMQRAYAALGL
PYLNQPQTQLQPQVPGQQPAQPQSHQQMRTLNPLGNNPMNIPAGGITTDQQPPNLISESA
LPTSLGATNPLMNDGSGSANLGTLSTIPTAAPPSSTGVRKSWHEHVTQDLRSHLVHKLVQ
AIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYKIQKELEEKRR
SRLHKQGILGNQPALPAPGAQPPGIPQAQPVRPPNGPMPLPVNRVQVSQGMNSFTPMSLG
NVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHSNNIMAQAPAQ
NQFLPQNQFQSSGGAMSVSSVGLGQPAAQTGVPQGQVPGAALPNPLNMLGPQASQLPCPP
VTQSPLHQTPPPASTAAGMPSLQHPSAPGMTPPQPAAPTQPSTPVSSSGQTPTPTPGSVP
SASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHAQPPGTPLSQAAAS
IDNRVPTPSSVASAETNSQQPGPEAPMLEMKAEVKTEDTEPDASESKGEPGSAMMEEDLQ
GSSQVKEETDTTEQKSEPMEVDEKKPEVKVETKEEEESSANGAASQSTSPSQPRKKIFKP
EELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQY
QEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGYCCGRKYEFS
PQTLCCYGKQLCTIPRDAAYYSYQNSSPKYGLLADRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESSAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HAHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPGVARTQPPTTVSAGKPANQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGVPPGRTGMVTPVGQMAPAGLNVPRPGPVSGPVVPNLPPGQWQQAPLPQQQPMPGMPR
PVMSMQAQPAVAGPRMPSVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQPQPGLQAQPGLHQQPGLQNLNAMQAGGPRPGVPPQ
QQAMGGLNPQGQALNIMNPGHNPSMASMNPQYREMGSWRPSQSS
NT seq 6615 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcggtgtttgccgtgtgacagagaagtctcctgcgagagcgtttgaagatttt
ggatcattgtttgacttggaaaatgatcttcctgatgagctgatccccaatggaggagaa
ttaggccttataaacagtgggaaccttgttccagatgctgcttccaaacataaacaactg
tcggagcttctgcgcggaggcagcggctctagtatcaacccaggaataggaaatgttagc
gccagcagccccgtgcagcaaggcctcggtgggcaggctcaagggcagccgaacagtgca
aacatggccagcctgggtgccatgggcaagagccctctgaaccagggagattcttcagcc
cccagcctgcccaaacaggcagccagcacctctgggcccactccccctgcttcccaagca
ctgaatccgcaagcacaaaagcaagtggggctggtgaccagcagccctgccacgtcgcag
acgggacctgggatctgcatgaatgctaactttaaccagacccaccctgccctcctcaat
agtaactctggccatagtttaatgaaccaggcccagcaaggacaggcgcaagtcatgaat
ggctctcttggggcggccggcagaggaaggggagctgggatgccgtaccccgcgcccgcc
atgcagggggcctcgagcagcgtgttggccgagacgttaacgcaggtctcgccgcaaatg
gccagtcacgcgggactgaacacggcgcaggcaggaggcatgaccaagatgggaatggct
ggtaacacaagtccatttggacaaccctttagtcaaactggagggcagcaaatgggagcc
cctggagtgaacccccagttatccagcaaacagagcatggtcaatagtttgcctcccttc
cctacagacatcaagaatccttccgtcaccaacgtgccaaacatgtctcagatgcaaact
tcagtgggaattgtacccacacaagcgatcacagcaggccccactgcagatcctgaaaag
cgcaaactgatacagcagcagctggttctactgcttcatgctcacaagtgtcagagacga
gaacaagcgaacggagaagttcgggcctgctctctcccgcattgccgaaccatgaagaat
gttttgaatcacatgacacactgtcaggctgggaaagcctgtcaagttgcccattgtgca
tcttcacgacaaatcatctctcattggaagaactgcacacgacatgactgtcctgtttgc
ctccctttgaaaaatgccagtgacaagcgaaaccaacaaaccatcctggggtctccagct
agtgggattcagaacacgatcggttctgtcggcaccggccagcagaacgccgcttcgctg
agtaacccgaatcccatagaccccagctccatgcagcgcgcgtatgctgcccttggtctc
ccctacctgaaccagccccagacgcagctgcagcctcaggttcccggccagcaaccagca
cagcctcaaagtcaccagcagatgaggactctcaaccccctgggaaataacccaatgaac
attccagcaggaggaataacaacagatcagcagccgccaaacttgatttcagaatcagct
cttccaacttccctcggggccacaaacccactgatgaacgatggctcaggctctgcaaac
ctcgggaccctcagcactatacccacagcggcacctccttccagcaccggcgtgcggaaa
agctggcacgaacatgtcactcaggacctgcggagccacctagtgcataaactggtccaa
gccatcttcccaacccctgacccggcagccctgaaggatcgccgcatggagaacctggtg
gcctatgctaagaaagtggagggggacatgtatgagtccgccaacagcagggatgaatac
tatcacttactggcagaaaaaatttacaagatacaaaaagaactagaagaaaagcggagg
tcacgtttacacaaacaaggcatcctgggtaaccagcccgccctaccagcccccggggca
cagccccctgggattccgcaggcacaacctgtgaggcctccaaatggacccatgcccctg
ccagtgaatcgcgtgcaggtttctcaagggatgaattcatttaccccaatgtccttgggg
aacgtacagttgccgcaggctcccatgggaccgcgtgcagcgtcccccatgaaccactct
gtcccgatgaacagcatgggctccgttccagggatggccatttctccttcccgaatgccc
cagcctccgaacatgatgggcgctcacagcaacaacatcatggcccaggcgcctgcgcag
aaccagttcctgcctcagaaccagttccagtcctccggcggggcgatgagtgtgagcagc
gtgggcctgggccagccggcggcccagacgggcgtgccgcagggacaggtgcctggtgct
gctcttcctaaccctctgaacatgcttgggcctcaggccagccagctgccttgtccacca
gtgacacagtcaccgttgcaccagacgccaccccctgcttccacggccgcgggcatgccg
tctctccagcacccgtcggcgcctgggatgactcctccccagccagcagctcccacccag
ccatcgactcctgtgtcgtcttccgggcagacccctaccccgactcccggctcggtgccc
agtgccagccagacccagagcaccccgacggtccaggcagcagcccaggcccaggtgacc
ccacagcctcagaccccagtccagcccccgtctgtggccacccctcagtcatcacaacag
cagccgacgcctgtgcatgcccagcctcccggcacaccgctttcccaggcagcagccagc
atcgataaccgggtccccactccttcctcggtggccagcgccgaaaccaactcccagcag
ccaggacccgaggcaccgatgctggagatgaaagcagaggtcaagactgaggacactgag
cctgatgccagtgaatccaagggggagccggggtctgcgatgatggaggaggatctgcaa
ggatcttctcaagttaaagaagaaacagacacaacagaacagaaatccgaaccgatggaa
gtggacgagaagaaaccggaagtcaaagtagaaactaaagaggaagaagagagcagcgct
aatggggccgcctctcagtcaacatctccttcacagccacgcaaaaaaatctttaagccg
gaagagttacgccaggctctgatgccaaccctggaagcgctgtaccgccaggacccggag
tccttgcctttccggcagcctgtggacccccagctgctagggatcccggattattttgac
attgtcaagaaccctatggacctttccaccatcaagcggaagctggacacggggcagtac
caagaaccctggcagtatgtggatgacgtctggctcatgttcaacaacgcctggctctat
aaccggaagacgtcccgggtctataagttctgcagcaaacttgctgaggtctttgagcag
gaaattgaccccgtcatgcagtcccttggatattgttgtgggcgcaagtatgagttttcc
ccacagactttgtgctgctatgggaagcagctgtgtacaattcctcgcgacgctgcctac
tacagctatcagaacagttcacccaagtatggccttcttgctgacaggtatcatttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaaccttttgtcgattgcaaggagtgtggccggaagatgcatcagatttgtgttctgcac
tatgacatcatttggccttcgggcttcgtgtgcgacaattgcctgaagaaaaccggcaga
actcggaaagaaaacaagttcagtgcgaagagactacagaccacgcgattgggcaaccac
ttggaagaccgagttaacaagtttttgcggcgacagaatcatcccgaagccggggaggtc
tttgtccgggtggtggccagctcagacaagactgtggaggtcaagcctgggatgaagtca
cggtttgtggattccggggaaatgtctgaatctttcccgtatcgaaccaaagcactcttt
gcttttgaggaaattgacggagtggatgtgtgcttctttggaatgcacgtgcaagagtac
ggctccgattgcccccctccaaacacaaggcgtgtatacatatcttatctggacagtatt
catttcttccggccccggtgcctccggaccgctgtttaccatgagatccttattggatat
ttagaatacgtgaagaaattggggtacgtaacgggacacatctgggcctgccccccgagt
gaaggagatgactatatcttccattgccacccccctgatcagaaaatccccaaaccaaag
cgcctgcaggagtggtacaagaagatgctggacaaggcatttgcagaacggatcattcac
gactacaaggacattttcaaacaagcgaccgaagacaggctcaccagtgccaaggagctg
ccctattttgagggtgacttctggcccaatgtgctggaggagagcattaaggagttggag
caagaagaagaagagaggaagaaggaggagagcagtgcagccagcgagaccacggagggc
agccagggtgacagcaagaatgccaagaagaagaacaacaagaaaaccaataagaataaa
agcagcatcagtcgagccaacaaaaagaagcccagcatgcccaacgtgtccaacgacttg
tcccagaagctctacgccaccatggagaagcacaaagaggtcttctttgtgattcacctg
cacgccgggcccgtcatcaacacactgccccccatcgtcgaccctgaccccctgctcagc
tgtgacctcatggacgggcgtgacgccttcctcacccttgccagagacaagcactgggag
ttctcgtccctgcgccggtccaagtggtccacgctgtgcatgctggtggagctgcacaca
cagggccaggaccggtttgtctacacctgcaacgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggactacgacctgtgcatcaactgctacaacacgaagagc
cacgcccacaagatggtgaagtgggggctgggcctggacgacgagggcagcagccagggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacgggggctgcccg
gtgtgcaagcagctcatcgccctctgctgctaccacgccaaacactgccaggagaacaaa
tgcccggtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggctcagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagtctgccttcccctacctcagcgccgcccgggacccccacgcagcagccc
agcacgccccagacgccgcagccacccgcccagccccagccctcgcccgtgagcatgtca
ccggccggcttccccggcgtggcccggactcagccccccaccacggtgtccgccgggaag
cccgccaaccaggtgccggccccgccgccccccgcccagcccccgccggccgcggtggaa
gcggcccggcagatcgagcgcgaggcgcagcagcagcagcacctgtaccgggtgaacatc
aacaacggcgtgcccccggggcgcacgggcatggtgaccccggtgggccagatggccccc
gcgggcctgaacgtgccccggcccggcccggtcagcgggcccgtcgtgcccaacctgccg
cccgggcagtggcagcaggcgcctctcccccagcagcagccgatgccgggcatgcccagg
cccgtgatgtccatgcaggcccagccggccgtggcagggcctcggatgcccagcgtgcag
ccgccccggagcatctcgcccggcgccctgcaggacctgttgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtcaaacccccagctgatg
gcggctttcatcaagcagcgcacggccaagtacgtggccagtcagcccggcctccagccc
cagcccggcctccagccccagcccggcctccaggcccagcccggcctgcaccagcagccc
ggcctgcagaacctgaacgccatgcaagccggcgggccccggcccggcgtgcccccgcag
cagcaggcgatgggaggcctgaacccccagggccaggccctgaacatcatgaacccgggg
cacaaccccagcatggcgagcatgaacccgcagtacagagagatggggtcgtggcggcca
agtcagagctcttga

DBGET integrated database retrieval system