KEGG   Felis catus (domestic cat): 101094588Help
Entry
101094588         CDS       T02385                                 

Gene name
NCOA1
Definition
nuclear receptor coactivator 1
Orthology
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101094588 (NCOA1)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101094588 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A3
AA seq 1382 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSISRVNPSVNSSISPAHGVARSSTLPPSSNNMVSPRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVGMTGTTCNNSNRSYSNIPVTS
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPTKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
SGTSGSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDIRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPAPEEIKLESQSQVGLPELELEAIDNQFGQPGTGDQIPWANNTVTTV
NQNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDK
LVQGGGLDVLSERFPPQQATPPLMMDERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLG
TMPVQVTPPRGAFSPSMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQ
FAANTPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQS
FGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPESTLA
NRNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEASFAPSLSPGSSMVPMP
IPPPQSSLLQQTPPTSGYQSPDMKAWQQGAMGNNNVFSQAVQSQPTPAQPGVYNNMSITV
SMAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKT
ETDGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLL
TE
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggaacaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacatcagtgacattgacagtttg
agtgtaaagccagacaaatgcaagattttgaagaagacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtgcagaaatcagacatctca
tcgagcagtcaaggagtgatagaaaaggaatccttgggacctcttctgttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcggagaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtaggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcaccgagaaccaagaagcttgccagcggtatgaagta
atgcagtgttttactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagctattaccggtgtagaa
tcctttatgaccaagcaagatactacaggcaaaatcatctctattgataccagttccctg
agagctgctggcagaactggctgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacaactgtttcaagaagtgatgacccgt
ggcactgcgtccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaagctttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaatttcccgagtaaacccgtccgtcaattctagtatctctccggctcatggtgtg
gctcgttcatccacattgccaccatccagcaacaacatggtatcccccagagtaaaccgc
caacagagctcagacctccatagcagcagtcatagtaactctagcaacagccaagggagt
ttcggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaacccctccttaaacctcaataattctcctatggaaggtacagga
atatctctcgcacagttcatgtctccaaggagacaagttagttctggattggcaacaagg
cccaggatgccaaacaattcgtttcctcctaatattccaacattaagctctcccgttggc
atgacaggtactacctgtaataatagtaaccgatcttattcaaacatcccagtaacatct
ttacagagtatgaatgaaggacccaataactccgttggcttctctgccagttctccagtc
ctcaggcagatgagctcgcagaattcacctagcagattaaatatacagcccacaaaagct
gagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtccgacaac
agctctagtgatggcaaacctctggattccgggcttctgcataacaatgacagactctca
gatggagacaataaatactcccaaaccagtcacaaactagtgcagcttctgacaacaaca
gcagagcagcagttacggcatgccgatatagacacaagttgcaaagaggtactgtcttgc
tcaggcacttccggctcggcctctgctaactcttcgagcggctcttgcccctcctctcat
agctcactgacagagcggcacaagattctgcacaggctcttacaggagggcagcccctcg
gatatcaccactttatctgtcgagcctgataaaaaggacagtgcgtctacttctgtgtca
gtgactggacaggtacaagggaactcgagcgtaaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgatatcttttagataaagatgagaaagatata
agatcaactccaaacctgagcctggatgatgtgaaggtgaaagtggaaaagaaagaacag
atggatccttgtaacacaaacccaaccccaatgaccaaacctgctcctgaggaaattaaa
ctggagtcccagagccaggtaggattaccggagctggaattggaagcaattgataaccag
tttggacagccaggaacaggtgatcagattccatgggcaaataatacagtgactaccgta
aatcagaataaaccagaagaccagtgtattagttcacaattagatgagcttctctgtcca
ccaacaacagtagaaggaagaaatgatgagaaggctcttcttgaacagctggtgtccttc
ctcagcggcaaagatgaaacggagctagctgaactagatagagctctggggattgacaaa
cttgtccagggaggtggattagatgtgttatcggagagatttccaccacaacaagcaaca
ccacctttgatgatggacgaaagacccaacctttattcccagccttattcttctccttca
cctactgccaatctctccagccctttccaaggcatggtcaggcaaaaaccttcactgggg
actatgcctgttcaagtaacacctccccgaggcgctttttcacccagcatgggcatgcag
cccagacagactctgaacagacctcccgctgcccccaaccagctgcggcttcaacttcag
cagcgcttgcagggacagcagcagttgatacaccaaaatcggcaagctatcttaaaccag
tttgcagcaaacactcccgttggcatcaatatgagatcaggcatgcagcagcagattaca
cctcagccacccctgaacgcccaaatgttggcacagcgccagcgggagttgtacagccaa
cagcaccgacagaggcagctaatacagcagcaaagagccatgctcatgaggcaacaaagc
tttgggaacaacctccctccctcatctggactgccagttcaaatggggaacccccgtctt
cctcagggtgctccgcagcaatttccctacccaccaaactatggtacaaatccaggaacc
ccacctgcttctaccagcccgttttcacaactggcagcaaatcccgagtcaaccttggcc
aaccgcaacagcatggtgaacagaggcatgacaggaaacatgggaggacagtttggcact
ggaatcaatcctcagatgcagcagaatgtcttccagtatccaggatcaggaatggttccc
caaggtgaggccagctttgctccatctctaagccctgggagctccatggtgccgatgcca
atccctcctcctcagagctctctgctccagcagactccacccacttctgggtaccagtca
ccagacatgaaggcctggcagcaaggagcaatgggaaacaacaacgtgttcagtcaagct
gtccagagccagcccacgcctgcgcagcccggagtgtacaacaatatgagcatcaccgtg
tccatggcaggtggaaacacaaatgttcagaacatgaacccgatgatgggccagatgcag
atgagctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatcca
gcactgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaaca
gaaacagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccaatgtaca
gtgaatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaa
cccacggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactg
actgaataa

DBGET integrated database retrieval system