KEGG   Felis catus (domestic cat): 101094588Help
Entry
101094588         CDS       T02385                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1 isoform X1
  KO
K09101  
nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Estrogen signaling pathway
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    101094588 (NCOA1)
   04919 Thyroid hormone signaling pathway
    101094588 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101094588 (NCOA1)
   05224 Breast cancer
    101094588 (NCOA1)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101094588 (NCOA1)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101094588 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
A3
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSISRVNPSVNSSISPAHGVARSSTLPPSSNNMVSPRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGNQIVASVALNQGQASSQSTNPSLNLNNSPMEGTG
ISLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPVGMTGTTCNNSNRSYSNIPVTS
LQSMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPTKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
SGTSGSASANSSSGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSVKLELDASKKKESKDHQLLRYLLDKDEKDIRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPAPEEIKLESQSQFTADLDQFDQLLPTLEKAAQLPGLCEPERMDGAV
TNVTIKSETLPASLQSTTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWANNTVTTVN
QNKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLMMDERPNLYSQPYSSPSPTANLSSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPSMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AANTPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPESTLAN
RNSMVNRGMTGNMGGQFGTGINPQMQQNVFQYPGSGMVPQGEASFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPTSGYQSPDMKAWQQGAMGNNNVFSQAVQSQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
TDGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcactgaaaagaggcgcagggaacaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacatcagtgacattgacagtttg
agtgtaaagccagacaaatgcaagattttgaagaagacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgatgaagtgcagaaatcagacatctca
tcgagcagtcaaggagtgatagaaaaggaatccttgggacctcttctgttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcggagaatgtg
accagctacttgggttacaatcaggaggaattaatgaataccagtgtctacagcatactg
catgtaggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcaccgagaaccaagaagcttgccagcggtatgaagta
atgcagtgttttactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtttgatttgtattgcacggcgattacctcggcctccagctattaccggtgtagaa
tcctttatgaccaagcaagatactacaggcaaaatcatctctattgataccagttccctg
agagctgctggcagaactggctgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacaactgtttcaagaagtgatgacccgt
ggcactgcgtccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaagctttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaatttcccgagtaaacccgtccgtcaattctagtatctctccggctcatggtgtg
gctcgttcatccacattgccaccatccagcaacaacatggtatcccccagagtaaaccgc
caacagagctcagacctccatagcagcagtcatagtaactctagcaacagccaagggagt
ttcggatgctcacctggaaatcagattgtagccagtgttgccttaaaccagggacaggcc
agttcccagagcactaacccctccttaaacctcaataattctcctatggaaggtacagga
atatctctcgcacagttcatgtctccaaggagacaagttagttctggattggcaacaagg
cccaggatgccaaacaattcgtttcctcctaatattccaacattaagctctcccgttggc
atgacaggtactacctgtaataatagtaaccgatcttattcaaacatcccagtaacatct
ttacagagtatgaatgaaggacccaataactccgttggcttctctgccagttctccagtc
ctcaggcagatgagctcgcagaattcacctagcagattaaatatacagcccacaaaagct
gagtccaaagataacaaagagattgcatccattttaaatgaaatgattcagtccgacaac
agctctagtgatggcaaacctctggattccgggcttctgcataacaatgacagactctca
gatggagacaataaatactcccaaaccagtcacaaactagtgcagcttctgacaacaaca
gcagagcagcagttacggcatgccgatatagacacaagttgcaaagaggtactgtcttgc
tcaggcacttccggctcggcctctgctaactcttcgagcggctcttgcccctcctctcat
agctcactgacagagcggcacaagattctgcacaggctcttacaggagggcagcccctcg
gatatcaccactttatctgtcgagcctgataaaaaggacagtgcgtctacttctgtgtca
gtgactggacaggtacaagggaactcgagcgtaaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgatatcttttagataaagatgagaaagatata
agatcaactccaaacctgagcctggatgatgtgaaggtgaaagtggaaaagaaagaacag
atggatccttgtaacacaaacccaaccccaatgaccaaacctgctcctgaggaaattaaa
ctggagtcccagagccagtttacagctgaccttgaccagtttgatcagttactacccaca
ctggagaaggcagcccagttgccaggtctgtgtgagccggagaggatggatggtgcggtc
accaatgtaacgatcaaatcagagaccctgccagcttcgcttcagtccaccactgccaga
cccacttccaggctgaatagattaccggagctggaattggaagcaattgataaccagttt
ggacagccaggaacaggtgatcagattccatgggcaaataatacagtgactaccgtaaat
cagaataaaccagaagaccagtgtattagttcacaattagatgagcttctctgtccacca
acaacagtagaaggaagaaatgatgagaaggctcttcttgaacagctggtgtccttcctc
agcggcaaagatgaaacggagctagctgaactagatagagctctggggattgacaaactt
gtccagggaggtggattagatgtgttatcggagagatttccaccacaacaagcaacacca
cctttgatgatggacgaaagacccaacctttattcccagccttattcttctccttcacct
actgccaatctctccagccctttccaaggcatggtcaggcaaaaaccttcactggggact
atgcctgttcaagtaacacctccccgaggcgctttttcacccagcatgggcatgcagccc
agacagactctgaacagacctcccgctgcccccaaccagctgcggcttcaacttcagcag
cgcttgcagggacagcagcagttgatacaccaaaatcggcaagctatcttaaaccagttt
gcagcaaacactcccgttggcatcaatatgagatcaggcatgcagcagcagattacacct
cagccacccctgaacgcccaaatgttggcacagcgccagcgggagttgtacagccaacag
caccgacagaggcagctaatacagcagcaaagagccatgctcatgaggcaacaaagcttt
gggaacaacctccctccctcatctggactgccagttcaaatggggaacccccgtcttcct
cagggtgctccgcagcaatttccctacccaccaaactatggtacaaatccaggaacccca
cctgcttctaccagcccgttttcacaactggcagcaaatcccgagtcaaccttggccaac
cgcaacagcatggtgaacagaggcatgacaggaaacatgggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggatcaggaatggttccccaa
ggtgaggccagctttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagctctctgctccagcagactccacccacttctgggtaccagtcacca
gacatgaaggcctggcagcaaggagcaatgggaaacaacaacgtgttcagtcaagctgtc
cagagccagcccacgcctgcgcagcccggagtgtacaacaatatgagcatcaccgtgtcc
atggcaggtggaaacacaaatgttcagaacatgaacccgatgatgggccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatccagca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
acagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccaatgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaaccc
acggcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system