KEGG   Felis catus (domestic cat): 101094596Help
Entry
101094596         CDS       T02385                                 

Gene name
21-OHase, CYP21
Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
fca  Felis catus (domestic cat)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101094596 (21-OHase)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     101094596 (21-OHase)
Cytochrome P450 [BR:fca00199]
 Cytochrome P450, animal type
  CYP21 family
   101094596 (21-OHase)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B2
AA seq 492 aa AA seqDB search
MLLLGLLLLTALAGARLLWNKWKYRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKLGPVYR
LRLGLQDVVVLNSKRTIEEALIRRWVDFAGRPQMPSYKLVSQHYQDLSLGDYSLLWKAHK
KLTRSALLLGIRNSMEPLVEQLTQEFCERMRAQAGTPVAIQKEFSFLTCSVICCLTFGDK
EDTLVHAFHDCVEDLMKSWEHWSIQVLDIVPFLRFFPNPGLRRLKQALENRDRIVEKQLR
QHKDSMVAGQWRDMTDYMLQGMGKPKVEKGHGRLLEGHVHMSVVDLFIGGTETTATTLSW
AVAFLLHHPEIQQRLQEELDCELGPGASGSRVPLKDPSRLPLLTATIAEVLRLRPVVPLA
LPHRTTRHSSILGYDIPEGTVVIPNLQGAHLDDTVWEQPHEFRPDRFLVPGASPRVLAFG
CGARVCLGEPLARLELFVVLARLLHAFTLLPPTGPLPSLRPRSHCGINLTMQPFQVRLQP
RGAVAPGPSQHQ
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgctactccttgggctgctgctgctgaccgcactggccggcgcccgcctgctgtggaac
aagtggaagtacaggagcctccacctcccacctcttgcccccggcttcctacacctgctg
cagcccgaccttcccatctatctgcttggtctgactcagaaactgggccctgtctatagg
ctccgcctcgggctgcaagatgtggtggtgctgaactctaagaggaccattgaggaggcc
ctgatcaggagatgggtagactttgctggcagaccccagatgccctcctataagctggta
tctcagcactaccaggacctctcactaggggactattccctgctctggaaggctcacaag
aaactcacccgctcggccctgctgctgggcatccgcaactccatggagccactggtggag
cagctgacccaggagttctgtgagcgcatgagagcccaggccggcacccctgtggccatc
cagaaggagttctctttcctcacctgcagtgtcatctgttgcctcaccttcggagacaag
gaggacaccttagtacatgcctttcatgactgtgtcgaagatttgatgaaaagctgggag
cactggtccatccaagttttggacatagttccctttctcaggttcttccccaacccaggc
ctccggaggctgaagcaggccttggagaacagggaccgcattgtagagaagcagctgagg
cagcacaaggacagcatggtggcaggccagtggagggacatgaccgactacatgctccaa
gggatggggaagccaaaagtggaaaagggccatggacggctccttgaaggacacgtgcat
atgtctgtggtggaccttttcattggtggcactgagaccacggcgaccaccctctcctgg
gctgtggcgttcttgcttcaccaccctgagattcagcagcgactgcaggaggagctggac
tgtgaactgggccctggggcttcaggctcccgagtcccgctcaaagacccttcacggctg
cccttgctcaccgccaccatcgctgaagtgctgcgcctgcggcctgttgtgcccctggcc
ctgcctcaccgcaccacgcggcatagcagcatcttaggctacgacatccccgagggcacg
gttgtcatccccaacctgcaaggcgcccacttggacgacacagtctgggagcagccacat
gagttccggccggatcgtttcctggtcccaggcgccagcccgagagtgctggcctttggc
tgcggagcgcgagtgtgcctgggcgagccgctggcacgccttgagctctttgtggtgctg
gcgcggctgctccacgccttcacgctgctgccccccacgggcccgctgccctctctgcga
cccaggtcccactgtggcatcaacctcacaatgcagcctttccaggtgcggctgcagccc
cggggagcagtggccccggggccgagccagcaccagtga

DBGET integrated database retrieval system