KEGG   Felis catus (domestic cat): 101094641Help
Entry
101094641         CDS       T02385                                 

Gene name
CYLD
Definition
cylindromatosis (turban tumor syndrome)
Orthology
K08601  
ubiquitin thioesterase CYLD [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Pathway
Osteoclast differentiation
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:fca04622]
Organismal Systems; Development; Osteoclast differentiation [PATH:fca04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E2
AA seq 954 aa AA seqDB search
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGI
YQGKQLFQCDEDCGVFVALDKLEILEDDDNGLESDYAGPGDTVQMELPPLEINSRVSLKL
GETTESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFASVESTILLHIN
DIIPALSDSVTQERRPPKLAFMSRGVADKGSSSHNKPKATGPTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISSDFGHASPPLQPPSMNSLSTENRFHSLP
FSLTKMPNANGSIGHSPLSLSVQSVMGELNNAPVQESPPLAMASGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEVSDDCILCDSPWYFXDYYXIRXLPPDPSLAPTA
LAPRQCRICGGLAMYECRECYDDPDISAGNIKQFCKTCNTQVHLHPKRLNHKYNPVSLPK
DLPDWDWRHGCIPCQKMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNGFN
IPQVTPCPEVGEYLKMSPEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaggcttatggagccaagaaaaagttacttcaccctactgggaagagcggatt
ttttatttgcttcttcaagaatgcagtgttacagacaaacaaacgcaaaagctccttaaa
gtaccaaaggggagtataggacagtatatccaagatcgttctgtggggcactcgaggatt
ccgtctgcaaaaggcaagaaaaatcagattggattaaaaatcctagagcaaccacacgcg
gttctctttgttgatgaaaaggatgttgtagaaataaatgaaaaattcacagagttgctt
ttggcaattaccaattgtgaagagaggttcagcctgtttaaaaacagaaacagactgagt
aaaggcctccagatagatgtgggctgccctgtgaaagtacagctgagatccggggaagaa
aaatttcctggagttgtgcgcttcagaggacccttattagcagagaggacagtatcggga
atattctttggagtagaactactggaagaaggccgtggccaaggttttactgacgggata
tatcaagggaaacagcttttccagtgtgatgaagactgtggagtgtttgttgcgttggac
aagctagaaatcctggaagatgatgacaatggattggaaagtgattatgcaggtccaggg
gacaccgtgcagatggaacttccgcccctggagataaactccagagtttctttgaagctc
ggagaaaccacagagtccggcacagttatattctgcgacgtcttgcctgggaaagaaagc
ttaggatattttgtcggtgtggacatggataatcctattggcaactgggatggaagattt
gatggggtgcaactttgtagtttcgcaagtgttgaaagtacaattctcttgcatatcaat
gatatcatcccagctttatcagatagcgtgacacaggaaaggaggcctcccaaacttgcc
tttatgtcaagaggtgttgcggacaaaggttcatccagtcataataaaccaaaggctaca
ggacctacctcagaccctggaaatagaaacagatctgaattattttataccttaaatgga
tcttctgttgactcacaaccacaatccaaatcaaaaaacacatggtacattgatgaagtt
gctgaagaccccgcaaagtcgcttacagagatatcttcagactttggacatgcttcacca
ccactgcaacctccttccatgaactcattatctaccgagaacagatttcactctttacca
ttcagtctgaccaagatgcccaatgccaatggaagcattggccacagcccgctttctctg
tcagttcagtccgtaatgggagagctaaacaatgcccctgtccaggagagtccacccttg
gccatggcttctgggaactcccatggtctggaagtgggctcactggctgaagttaaagag
aatcctcctttctatggggtaattcgttggatcggtcagccgccaggactcaacgaagtg
ctagctggactggaactggaagatgaatgtgcgggctgtacagacggaacctttaggggc
acacggtacttcacttgtgccctgaagaaggcgctgtttgttaagctgaagagctgcagg
cccgactcgagatttgcatccctgcagccagtttccaatcagatcgaacgctgtaactca
ctggcattcggaggctacttgagtgaagtagtggaagaaaataccccacccaaaatggaa
aaagaaggtttagagataatgattggaaagaagaagggtatccagggtcattacaattct
tgttacttagactcaaccttattctgcttgtttgcttttagttctgtcctggacactgtg
ctacttagacctaaagaaaagaatgatgtagaatattatagtgaaacgcaagagctactg
aggacggaaatcgtgaatcctctgagaatatacggatatgtgtgtgcaacaaagattatg
aaactgaggaaaatacttgaaaaagttgaggctgcatcaggatttacctcggaagaaaaa
gatcctgaagagttcttgaatatcctgtttcatcatattttaagggtagaaccattgtta
aaaataaggtcagcaggtcaaaaagtgcaagattgttacttctatcaaatttttatggaa
aaaaatgagaaagttggagttcctacaattcagcaattgttagaatggtcttttatcaac
agtaacctgaagtttgcagaggttagtgatgattgtattttatgtgacagtccttggtat
ttttaagactactactagattcgataactgccccctgacccctctctcgcccctaccgct
ttagcccccaggcagtgccggatctgcggggggctcgccatgtacgagtgtagagagtgt
tatgatgatcccgacatctcagccggaaacatcaagcagttttgtaaaacctgcaacacc
caagtccacctccatcccaagagactgaaccataaatacaacccagtgtcgcttcccaaa
gatttacccgactgggactggaggcacggctgcatcccctgccagaagatggaactgttt
gctgtcctctgcatagaaacgagccactatgtcgcttttgtgaagtacgggaaggacgac
tctgcctggctcttctttgacagcatggccgatcgagatggtggtcagaatggcttcaac
attcctcaggttaccccatgcccggaagtaggagagtacttgaaaatgtctccggaagac
ctacactccttggactccagaagaatccaaggctgtgcgcgaagacttctctgtgatgcg
tacatgtgcatgtaccagagtccaacaatgagtctgtacaaataa

DBGET integrated database retrieval system