KEGG   Felis catus (domestic cat): 101094658Help
Entry
101094658         CDS       T02385                                 

Gene name
CACNA2D3
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3 isoform X4
  KO
K04860  voltage-dependent calcium channel alpha-2/delta-3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04921  Oxytocin signaling pathway
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101094658 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    101094658 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    101094658 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    101094658 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101094658 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101094658 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    101094658 (CACNA2D3)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   101094658 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 dCache_1 VWA VWA_2 dCache_2 Cache_3-Cache_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 101094658
NCBI-ProteinID: XP_019678571
Ensembl: ENSFCAG00000010121
Position
A2
AA seq 997 aa AA seqDB search
MEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQYEYFNAVLINERDKDGNFLELGKEFIL
APNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYF
GSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTI
AKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKG
IGMLDIALNEAFNILSDFNHTGQGSVCSQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFT
YLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTE
AYIDSTLPQAQKLADDQGLVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIP
KYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNA
MVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVT
IEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEV
LFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKA
GDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGIVNKSNVVTASTSIQLLDERKSPV
VAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQT
GDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKDSSDSASGLLDPYHAFLAAVKWI
MTELVLFLVEFNLCSWWHSDMAATAQKLKQTLEPCDTEYPAFVSERTIKETSGNIACEDC
SKSFVIQQIPSSNLFMVVVDSSCLCESVTPITMAPIEIRYNESLKCERLKAQKIRRRPES
CHGFHPEENARECGGAPSLQAKMVLVVFPLLLMLFSR
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggaagagatgtttcacaaaaagtctgaagcagtgcggcgtcttgtggaggctgcagaa
gaggcacatctgaaacatgaatttgatgcagacttgcagtatgaatacttcaatgctgtg
ctgataaacgaaagggacaaagatgggaattttttggagctggggaaggaattcatctta
gccccaaatgaccattttaataatttgcctgtgaacatcagtctgagtgacgtccaggtg
ccaacgaacatgtacaacaaagacccagcaatcgtcaatggggtttattggtccgaatcc
ctaaacaaagttttcgtagataactttgatcgtgacccgtctctcatatggcagtacttt
ggaagtgcaaagggcttttttaggcagtatccagggattaaatgggaaccagatgagaat
ggagtcattgcctttgactgcaggaaccgaaaatggtacatccaagcagcgacttctccg
aaagacgtggtcattttagtggacgtcagtggcagcatgaaagggctccgtctgactatt
gcaaagcaaaccgtctcatctattctggatacgctgggggatgatgactttttcaacata
attgcttataatgaggagcttcactatgtggaaccttgcctgaacgggacattggtgcaa
gctgacaggacaaacaaggagcacttcagggagcatctggacaagctgtttgccaaagga
attggaatgctggatatagctctgaatgaggccttcaacattctcagtgatttcaaccat
actgggcaaggcagcgtctgcagccaggccatcatgctcatcaccgatggggcagtggac
acctatgacactatctttgcgaagtacaactggccagatcggaaggtccgcatcttcacc
tacctcattggacgggaggctgcttttgcagacaatctcaagtggatggcttgcgccaac
aaaggatttttcacccagatctccaccttggctgatgtgcaggaaaatgtcatggaatac
ctgcatgtactcagccggcccaaagtcatcgatcaggagcacgacgtggtatggactgaa
gcttacatcgacagcactctccctcaggcacaaaagcttgccgatgatcagggcctcgtc
ctgatgaccacggtcgccatgcctgtgtttagtaagcagaacgaaactagatcaaagggc
attcttctgggtgtggttggcacagatgtcccagtgaaagagcttctgaagaccatcccc
aaatacaagttagggattcacggttatgcctttgcgatcacaaataatggatatatcctg
acgcatccagaactcagaccactgtacgaggaaggaaaaaagcgaaggaaacctaactac
agtagcgttgacctctcagaggtagagtgggaagaccgggatgatgtgttaagaaacgcc
atggtgaaccgaaagactgggaagttctctatggaggtgaagaagacagtggacaaaggg
aaacgggttttggtgatgacaaatgactactattatacagacatcaagggtacccctttc
agcttaggtgtggcgctctccagaggccatgggaaatatttcttccgagggaatgtaacc
attgaagaaggcctgcatgacttagagcaccctgacgtatccctggcagatgaatggtcc
tactgcaacactgacctacacccggagcaccgtcatctatctcagctagaagccatcaag
ctctacctcaaaggcaaagaacctctgctccaatgtgataaagaattgatacaagaagtc
ctttttgatgccgtggtgagcgctcccattgaagcatattggaccagtcttgccctcaac
aaatctgagaactctgacaagggcgtggaggtcgccttcctcggcactcgtacgggcctc
tcgaggatcaacctgtttgttggggctgagcagctcaccaatcaggatttcctgaaagct
ggagacaaggagaacatttttaacgcagaccatttccctctctggtaccgaagagctgcg
gagcagattccagggagcttcgtctactccatcccgttcagcacaggaatagtcaacaaa
agcaatgtggtgacagcgagtacctccatccagctcctcgatgaacggaaatctcctgtg
gtagcagctgtaggcattcagatgaaacttgaatttttccagaggaagttctggactgcc
agcagacagtgtgcctctctggatggcaaatgctccatcagctgtgatgacgagactgtg
aactgttacctcatagacaataatgggtttattctggtgtctgaagactacacccagact
ggagacttttttggcgaggtcgaaggggccgtgatgaacaaactgttaacaatgggctcc
tttaaaagaattaccctgtatgactatcaagccatgtgcagggccaacaaggacagcagt
gacagtgccagtgggctactggatccttatcatgccttccttgctgcagtaaaatggata
atgacagaacttgtcttgtttctggtggaatttaacctctgcagctggtggcactcagat
atggcagccacagcccagaaattgaagcagaccctggaaccttgtgatacagagtatcca
gcgtttgtctctgagcgcaccatcaaggaaacctcagggaacattgcttgtgaagactgc
tctaagtcctttgtcatccagcaaatcccaagcagcaatctgttcatggtggtggtggac
agcagctgcctgtgtgagtccgtgacccccatcaccatggcccccattgaaatcaggtat
aacgaatcccttaagtgtgaacgtttaaaggcccagaagatcagaaggcgtcccgagtct
tgtcatggcttccatcctgaggagaatgcaagggagtgtgggggtgcaccgagcctgcag
gccaagatggtccttgtcgtcttccctctgctcttgatgctcttttcaaggtga

DBGET integrated database retrieval system