KEGG   Felis catus (domestic cat): 101094658Help
Entry
101094658         CDS       T02385                                 

Gene name
CACNA2D3
Definition
(RefSeq) calcium channel, voltage-dependent, alpha 2/delta subunit 3
  KO
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101094658 (CACNA2D3)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    101094658 (CACNA2D3)
  Circulatory system
   04260 Cardiac muscle contraction
    101094658 (CACNA2D3)
   04261 Adrenergic signaling in cardiomyocytes
    101094658 (CACNA2D3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101094658 (CACNA2D3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101094658 (CACNA2D3)
   05414 Dilated cardiomyopathy (DCM)
    101094658 (CACNA2D3)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   101094658 (CACNA2D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 1084 aa AA seqDB search
MSSEQELRARQDKNLCPGTFGEAFGPVTNSGMTMVKLWASAFGGEIKSIAAKYSGSQLLQ
KKYKEYEKDVAIEEIDGLQLVKKLAKNMEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQ
YEYFNAVLINERDKDGNFLELGKEFILAPNDHFNNLPVNISLSDVQVPTNMYNKDPAIVN
GVYWSESLNKVFVDNFDRDPSLIWQYFGSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWY
IQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFNIIAYNEELHYVEPC
LNGTLVQADRTNKEHFREHLDKLFAKGIGMLDIALNEAFNILSDFNHTGQGSVCSQAIML
ITDGAVDTYDTIFAKYNWPDRKVRIFTYLIGREAAFADNLKWMACANKGFFTQISTLADV
QENVMEYLHVLSRPKVIDQEHDVVWTEAYIDSTLPQAQKLADDQGLVLMTTVAMPVFSKQ
NETRSKGILLGVVGTDVPVKELLKTIPKYKLGIHGYAFAITNNGYILTHPELRPLYEEGK
KRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYT
DIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHL
SQLEAIKLYLKGKEPLLQCDKELIQEVLFDAVVSAPIEAYWTSLALNKSENSDKGVEVAF
LGTRTGLSRINLFVGAEQLTNQDFLKAGDKENIFNADHFPLWYRRAAEQIPGSFVYSIPF
STGIVNKSNVVTASTSIQLLDERKSPVVAAVGIQMKLEFFQRKFWTASRQCASLDGKCSI
SCDDETVNCYLIDNNGFILVSEDYTQTGDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMC
RANKDSSDSASGLLDPYHAFLAAVKWIMTELVLFLVEFNLCSWWHSDMAATAQKLKQTLE
PCDTEYPAFVSERTIKETSGNIACEDCSKSFVIQQIPSSNLFMVVVDSSCLCESVTPITM
APIEIRYNESLKCERLKAQKIRRRPESCHGFHPEENARECGGAPSLQAKMVLVVFPLLLM
LFSR
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgagcaggaactcagagcaagacaggacaagaacctgtgtcctggaactttt
ggggaagcctttggacctgtcaccaacagtggaatgacaatggtgaagctctgggcctcg
gcttttggtggggagataaaatccattgctgctaagtactctggttcccagcttctgcaa
aagaaatacaaagagtatgagaaagacgtagccatagaagaaatcgatggcctccaactg
gtgaaaaagctggcaaagaacatggaagagatgtttcacaaaaagtctgaagcagtgcgg
cgtcttgtggaggctgcagaagaggcacatctgaaacatgaatttgatgcagacttgcag
tatgaatacttcaatgctgtgctgataaacgaaagggacaaagatgggaattttttggag
ctggggaaggaattcatcttagccccaaatgaccattttaataatttgcctgtgaacatc
agtctgagtgacgtccaggtgccaacgaacatgtacaacaaagacccagcaatcgtcaat
ggggtttattggtccgaatccctaaacaaagttttcgtagataactttgatcgtgacccg
tctctcatatggcagtactttggaagtgcaaagggcttttttaggcagtatccagggatt
aaatgggaaccagatgagaatggagtcattgcctttgactgcaggaaccgaaaatggtac
atccaagcagcgacttctccgaaagacgtggtcattttagtggacgtcagtggcagcatg
aaagggctccgtctgactattgcaaagcaaaccgtctcatctattctggatacgctgggg
gatgatgactttttcaacataattgcttataatgaggagcttcactatgtggaaccttgc
ctgaacgggacattggtgcaagctgacaggacaaacaaggagcacttcagggagcatctg
gacaagctgtttgccaaaggaattggaatgctggatatagctctgaatgaggccttcaac
attctcagtgatttcaaccatactgggcaaggcagcgtctgcagccaggccatcatgctc
atcaccgatggggcagtggacacctatgacactatctttgcgaagtacaactggccagat
cggaaggtccgcatcttcacctacctcattggacgggaggctgcttttgcagacaatctc
aagtggatggcttgcgccaacaaaggatttttcacccagatctccaccttggctgatgtg
caggaaaatgtcatggaatacctgcatgtactcagccggcccaaagtcatcgatcaggag
cacgacgtggtatggactgaagcttacatcgacagcactctccctcaggcacaaaagctt
gccgatgatcagggcctcgtcctgatgaccacggtcgccatgcctgtgtttagtaagcag
aacgaaactagatcaaagggcattcttctgggtgtggttggcacagatgtcccagtgaaa
gagcttctgaagaccatccccaaatacaagttagggattcacggttatgcctttgcgatc
acaaataatggatatatcctgacgcatccagaactcagaccactgtacgaggaaggaaaa
aagcgaaggaaacctaactacagtagcgttgacctctcagaggtagagtgggaagaccgg
gatgatgtgttaagaaacgccatggtgaaccgaaagactgggaagttctctatggaggtg
aagaagacagtggacaaagggaaacgggttttggtgatgacaaatgactactattataca
gacatcaagggtacccctttcagcttaggtgtggcgctctccagaggccatgggaaatat
ttcttccgagggaatgtaaccattgaagaaggcctgcatgacttagagcaccctgacgta
tccctggcagatgaatggtcctactgcaacactgacctacacccggagcaccgtcatcta
tctcagctagaagccatcaagctctacctcaaaggcaaagaacctctgctccaatgtgat
aaagaattgatacaagaagtcctttttgatgccgtggtgagcgctcccattgaagcatat
tggaccagtcttgccctcaacaaatctgagaactctgacaagggcgtggaggtcgccttc
ctcggcactcgtacgggcctctcgaggatcaacctgtttgttggggctgagcagctcacc
aatcaggatttcctgaaagctggagacaaggagaacatttttaacgcagaccatttccct
ctctggtaccgaagagctgcggagcagattccagggagcttcgtctactccatcccgttc
agcacaggaatagtcaacaaaagcaatgtggtgacagcgagtacctccatccagctcctc
gatgaacggaaatctcctgtggtagcagctgtaggcattcagatgaaacttgaatttttc
cagaggaagttctggactgccagcagacagtgtgcctctctggatggcaaatgctccatc
agctgtgatgacgagactgtgaactgttacctcatagacaataatgggtttattctggtg
tctgaagactacacccagactggagacttttttggcgaggtcgaaggggccgtgatgaac
aaactgttaacaatgggctcctttaaaagaattaccctgtatgactatcaagccatgtgc
agggccaacaaggacagcagtgacagtgccagtgggctactggatccttatcatgccttc
cttgctgcagtaaaatggataatgacagaacttgtcttgtttctggtggaatttaacctc
tgcagctggtggcactcagatatggcagccacagcccagaaattgaagcagaccctggaa
ccttgtgatacagagtatccagcgtttgtctctgagcgcaccatcaaggaaacctcaggg
aacattgcttgtgaagactgctctaagtcctttgtcatccagcaaatcccaagcagcaat
ctgttcatggtggtggtggacagcagctgcctgtgtgagtccgtgacccccatcaccatg
gcccccattgaaatcaggtataacgaatcccttaagtgtgaacgtttaaaggcccagaag
atcagaaggcgtcccgagtcttgtcatggcttccatcctgaggagaatgcaagggagtgt
gggggtgcaccgagcctgcaggccaagatggtccttgtcgtcttccctctgctcttgatg
ctcttttcaaggtga

DBGET integrated database retrieval system