KEGG   Felis catus (domestic cat): 101094713Help
Entry
101094713         CDS       T02385                                 

Gene name
KAT2A
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase KAT2A
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05166  HTLV-I infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101094713 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101094713 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101094713 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    101094713 (KAT2A)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101094713 (KAT2A)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101094713 (KAT2A)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101094713 (KAT2A)
   HAT complexes
    PCAF complex
     101094713 (KAT2A)
    STAGA complex
     101094713 (KAT2A)
    TFTC complex
     101094713 (KAT2A)
    SAGA complex
     101094713 (KAT2A)
    SLIK complex
     101094713 (KAT2A)
    ADA-HAT complex
     101094713 (KAT2A)
    HAT-A2 complex
     101094713 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 T2SSM
Motif
Other DBs
NCBI-GeneID: 101094713
NCBI-ProteinID: XP_023099197
Ensembl: ENSFCAG00000002146
Position
E1
AA seq 840 aa AA seqDB search
MAEPTQASTPAPATQSRPLQSPAPAPTPTPAPSPASAPTPAPTPAPAPAPAAAPAGSTGT
GAPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEEEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHIFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGGSNSSLS
LDSGGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSMSKSRXVRGYGTHLMNH
LKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNP
RIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWK
PLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKT
MTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccgacccaggcctcaaccccggcgccggccacgcagtcccgtccccttcag
tctccagcccctgccccaactccgactcctgcccccagcccggcttcagccccgactccg
gctcccactccggcaccagcccccgccccagctgcagccccagccgggagcacagggact
ggggctcccggggtaggaagtggggggaccgggagcggaggggatccggctcgacctggc
ctgagccagcagcagcgcgccagccagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgcaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggacctacagcagccagct
gccaacctgagcgagctatgccgcagctgtgagcaccccttggctgaccacgtgtcccac
ctggagaatgtgtcagaggaggagattaaccggctactgggtatggtggtggacgtggag
aacctattcatgtctgttcataaggaggaggacacagacactaagcaggtgtatttctac
ctcttcaagcttctgcggaaatgcatcctgcagatgacccggccagtggtggagggctcc
ctgggcagtcccccgtttgagaagcctaatattgaacagggtgtgctgaactttgtgcaa
tacaagtttagtcacctcgcccctcgggagcggcagacgatgtttgagctctcaaagatg
ttcctgctctgccttaactactggaagcttgagacgcctgcccaatttcggcagcggtct
caggccgaggacgtggctacctacaaggtcaattataccagatggctctgctactgccac
gtgccccagagctgtgatagcctcccccgctacgagaccactcacatctttgggcgaagc
cttctccgctctatcttcactgtgacccggcggcagctgctagagaaattccgggtggaa
aaggacaagctggtgcctgagaagaggaccctcatcctcacccacttcccaaaattcctg
tccatgctggaggaggagatctatggggcgaactctccgatctgggagtcgggcttcacc
atgccgccctcagaggggacccagctggtgcccaggccagctacggtcagcgcggcagtt
gttcccagcgcccccatcttcagccccaccatgggtgggggcagcaacagctccttgagt
ctggattccggaggggctgagcccatgccaggtgagaagaggaagctcccagagaacctg
accctggaggatgccaagcggctccgcgtgatgggcgacatccccatggagttggtcaac
gaggtcatgctcaccatcaccgaccctgccgccatgctggggcctgagacgagcctgctg
tctgccaacgcagcccgggacgagacggcccgcctagaggagcgccgcggcatcattgag
ttccatgtcatcggcaactcactgacgcccaaggccaaccggcgggtattgctgtggctc
gtggggctgcagaatgtcttctcccaccagctgccgcgcatgcccaaggagtacatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggatgggcgggtcatt
ggtgggatctgcttccgcatgtttcccacccagggcttcacagagattgtcttctgtgct
gtcacctcaatgagcaagtcaaggtgagtgcgtggctatgggactcacctgatgaaccac
ttgaaggagtatcacatcaaacacaacattctctacttcctcacctatgccgacgagtac
gccattggctacttcaaaaagcagggcttctccaaggacatcaaggttcccaagagccgc
tacctgggctacattaaggactatgagggtgcaacattgatggagtgtgagctgaatccc
cggatcccctacacggagctgtcccacatcatcaaaaagcagaaggagatcatcaagaag
ctgattgagcgcaaacaagcccagatccgaaaggtctaccccgggctcagctgcttcaag
gagggtgtgaggcagatccctgtggagagtgtccccggcattcgagagacaggctggaag
ccgttggggaaggagaaggggaaggagctgaaggatccagaccagctctacacaaccctc
aaaaacttgctggcccagatcaagtcacaccccagtgcctggcccttcatggagcctgtg
aagaagtcagaggcccctgactactatgaggtcatccgcttccctattgacctgaagacc
atgacggagcgactgcgcagccgctactatgtcacccggaagctctttgtggctgacctg
cagcgggtcattgccaactgccgcgagtacaaccccccggacagcgagtactgccgctgt
gccagcgccctggagaagttcttctacttcaagctcaaggaggggggcctcattgacaag
tag

DBGET integrated database retrieval system