KEGG   Felis catus (domestic cat): 101094713Help
Entry
101094713         CDS       T02385                                 

Gene name
KAT2A
Definition
K(lysine) acetyltransferase 2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:fca04330]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:fca04919]
Human Diseases; Cancers; Viral carcinogenesis [PATH:fca05203]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:fca05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 837 aa AA seqDB search
MAEPTQASTPAPATQSRPLQSPAPAPTPTPAPSPASAPTPAPTPAPAPAPAAAPAGSTGT
GAPGVGSGGTGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEEEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHIFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPATVSAAVVPSAPIFSPTMGGGSNSSLS
LDSGGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccgacccaggcctcaaccccggcgccggccacgcagtcccgtccccttcag
tctccagcccctgccccaactccgactcctgcccccagcccggcttcagccccgactccg
gctcccactccggcaccagcccccgccccagctgcagccccagccgggagcacagggact
ggggctcccggggtaggaagtggggggaccgggagcggaggggatccggctcgacctggc
ctgagccagcagcagcgcgccagccagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgcaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggacctacagcagccagct
gccaacctgagcgagctatgccgcagctgtgagcaccccttggctgaccacgtgtcccac
ctggagaatgtgtcagaggaggagattaaccggctactgggtatggtggtggacgtggag
aacctattcatgtctgttcataaggaggaggacacagacactaagcaggtgtatttctac
ctcttcaagcttctgcggaaatgcatcctgcagatgacccggccagtggtggagggctcc
ctgggcagtcccccgtttgagaagcctaatattgaacagggtgtgctgaactttgtgcaa
tacaagtttagtcacctcgcccctcgggagcggcagacgatgtttgagctctcaaagatg
ttcctgctctgccttaactactggaagcttgagacgcctgcccaatttcggcagcggtct
caggccgaggacgtggctacctacaaggtcaattataccagatggctctgctactgccac
gtgccccagagctgtgatagcctcccccgctacgagaccactcacatctttgggcgaagc
cttctccgctctatcttcactgtgacccggcggcagctgctagagaaattccgggtggaa
aaggacaagctggtgcctgagaagaggaccctcatcctcacccacttcccaaaattcctg
tccatgctggaggaggagatctatggggcaaactctccgatctgggagtcgggcttcacc
atgccgccctcagaggggacccagctggtgcccaggccagctacggtcagcgcggcagtt
gttcccagcgcccccatcttcagccccaccatgggtgggggcagcaacagctccttgagt
ctggattccggaggggctgagcccatgccaggtgagaagaggaagctcccagagaacctg
accctggaggatgccaagcggctccgcgtgatgggcgacatccccatggagttggtcaac
gaggtcatgctcaccatcaccgaccctgccgccatgctggggcctgagacgagcctgctg
tctgccaacgcagcccgggacgagacggcccgcctagaggagcgccgcggcatcattgag
ttccatgtcatcggcaactcactgacgcccaaggccaaccggcgggtattgctgtggctc
gtggggctgcagaatgtcttctcccaccagctgccgcgcatgcccaaggagtacatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggatgggcgggtcatt
ggtgggatctgcttccgcatgtttcccacccagggcttcacagagattgtcttctgtgct
gtcacctcaaatgagcaagtcaagggctatgggactcacctgatgaaccacttgaaggag
tatcacatcaaacacaacattctctacttcctcacctatgccgacgagtacgccattggc
tacttcaaaaagcagggcttctccaaggacatcaaggttcccaagagccgctacctgggc
tacattaaggactatgagggtgcaacattgatggagtgtgagctgaatccccggatcccc
tacacggagctgtcccacatcatcaaaaagcagaaggagatcatcaagaagctgattgag
cgcaaacaagcccagatccgaaaggtctaccccgggctcagctgcttcaaggagggtgtg
aggcagatccctgtggagagtgtccccggcattcgagagacaggctggaagccgttgggg
aaggagaaggggaaggagctgaaggatccagaccagctctacacaaccctcaaaaacttg
ctggcccagatcaagtcacaccccagtgcctggcccttcatggagcctgtgaagaagtca
gaggcccctgactactatgaggtcatccgcttccctattgacctgaagaccatgacggag
cgactgcgcagccgctactatgtcacccggaagctctttgtggctgacctgcagcgggtc
attgccaactgccgcgagtacaaccccccggacagcgagtactgccgctgtgccagcgcc
ctggagaagttcttctacttcaagctcaaggaggggggcctcattgacaagtag

DBGET integrated database retrieval system