KEGG   Felis catus (domestic cat): 101094975Help
Entry
101094975         CDS       T02385                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
fca  Felis catus (domestic cat)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:fca04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:fca04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A1
AA seq 329 aa AA seqDB search
MEPNGTFSSNVSNTDCSIENFKRHFYPIVYLIIFVWGTLGNGFSIYVFLQPYKKSTSVNV
FMLNLAISDFLFTSTLPFRVDYYIRGSNWIFGDLSCRIMSYSMYVNMYSSIYFLTVLSIV
RFLATVHPFRFLHVASIRSAWILCVVIWVLIMASSVVLLNNGSEQNGNTTLCLELNMNKI
VKLKTMNYIALVIGFMLPFCLLSICYLLIIRVLLKVKVPESGLRVSHKKALITIIIALII
FLLCFLPYHILRTLHLVMWKVDKCEDNLHKAVVITLTLAATNSCLNPLLYYFAGENFKDR
LRSALRKDHPWKTKCSIPVCMWLKEETQV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaacccaatggcaccttcagcagtaatgtcagcaacacggactgttcaatcgaaaac
ttcaaaaggcatttttaccccattgtgtacctgataatatttgtctggggaaccttggga
aatggattttccatatatgttttcctgcagccttataagaagtccacgtctgtgaatgtt
ttcatgctaaacctggccatttcagattttttgttcacaagtacactgcccttcagagtt
gactattacatcagaggctccaattggatatttggggacctgagctgcaggattatgtct
tattctatgtatgtcaacatgtacagcagcatttatttcctgactgtgctgagcattgtg
cgttttctggcaactgttcatcccttccggttcctccatgtggctagtatcaggagtgcc
tggattctgtgtgtggtcatatgggtccttatcatggcttcgtcagtagtgcttctgaac
aatggctctgagcagaatggcaataccacattatgcttagagttgaatatgaataaaatt
gttaaactgaagacgatgaactacattgccttggtgataggcttcatgctaccattctgc
ttgctcagcatctgttatctgctaatcattcgagtcctgttaaaggtaaaggtcccagaa
tctgggctgcgggtttctcacaagaaagcacttatcaccatcatcattgccttgatcatc
ttccttctgtgtttcctgccttatcacatactgagaaccctccacctggtcatgtggaaa
gtggataaatgcgaagacaatcttcataaagctgtggtcatcacactgacgttggcagca
accaatagctgccttaatcctttgctctattattttgctggggaaaattttaaggacaga
ctaaggtctgcactcagaaaagatcacccatggaagacaaagtgcagcattcctgtctgc
atgtggttgaaagaggaaacacaagtttaa

DBGET integrated database retrieval system