KEGG   Felis catus (domestic cat): 101094975Help
Entry
101094975         CDS       T02385                                 

Gene name
CYSLTR2
Definition
cysteinyl leukotriene receptor 2
Orthology
K04323  
cysteinyl leukotriene receptor 2
Organism
fca  Felis catus (domestic cat)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101094975 (CYSLTR2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101094975 (CYSLTR2)
G protein-coupled receptors [BR:fca04030]
 Class A. Rhodopsin family
  Other
   Cysteinyl leukotriene
    101094975 (CYSLTR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A1
AA seq 329 aa AA seqDB search
MEPNGTFSSNVSNTDCSIENFKRHFYPIVYLIIFVWGTLGNGFSIYVFLQPYKKSTSVNV
FMLNLAISDFLFTSTLPFRVDYYIRGSNWIFGDLSCRIMSYSMYVNMYSSIYFLTVLSIV
RFLATVHPFRFLHVASIRSAWILCVVIWVLIMASSVVLLNNGSEQNGNTTLCLELNMNKI
VKLKTMNYIALVIGFMLPFCLLSICYLLIIRVLLKVKVPESGLRVSHKKALITIIIALII
FLLCFLPYHILRTLHLVMWKVDKCEDNLHKAVVITLTLAATNSCLNPLLYYFAGENFKDR
LRSALRKDHPWKTKCSIPVCMWLKEETQV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaacccaatggcaccttcagcagtaatgtcagcaacacggactgttcaatcgaaaac
ttcaaaaggcatttttaccccattgtgtacctgataatatttgtctggggaaccttggga
aatggattttccatatatgttttcctgcagccttataagaagtccacgtctgtgaatgtt
ttcatgctaaacctggccatttcagattttttgttcacaagtacactgcccttcagagtt
gactattacatcagaggctccaattggatatttggggacctgagctgcaggattatgtct
tattctatgtatgtcaacatgtacagcagcatttatttcctgactgtgctgagcattgtg
cgttttctggcaactgttcatcccttccggttcctccatgtggctagtatcaggagtgcc
tggattctgtgtgtggtcatatgggtccttatcatggcttcgtcagtagtgcttctgaac
aatggctctgagcagaatggcaataccacattatgcttagagttgaatatgaataaaatt
gttaaactgaagacgatgaactacattgccttggtgataggcttcatgctaccattctgc
ttgctcagcatctgttatctgctaatcattcgagtcctgttaaaggtaaaggtcccagaa
tctgggctgcgggtttctcacaagaaagcacttatcaccatcatcattgccttgatcatc
ttccttctgtgtttcctgccttatcacatactgagaaccctccacctggtcatgtggaaa
gtggataaatgcgaagacaatcttcataaagctgtggtcatcacactgacgttggcagca
accaatagctgccttaatcctttgctctattattttgctggggaaaattttaaggacaga
ctaaggtctgcactcagaaaagatcacccatggaagacaaagtgcagcattcctgtctgc
atgtggttgaaagaggaaacacaagtttaa

DBGET integrated database retrieval system