KEGG   Felis catus (domestic cat): 101095062Help
Entry
101095062         CDS       T02385                                 

Gene name
DYRK1B
Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 1B isoform X5
  KO
K08825  dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101095062 (DYRK1B)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   101095062 (DYRK1B)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    101095062 (DYRK1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Choline_kinase
Motif
Other DBs
NCBI-GeneID: 101095062
NCBI-ProteinID: XP_003997853
Ensembl: ENSFCAG00000003021
UniProt: M3VZK5
Position
E2
AA seq 629 aa AA seqDB search
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSTKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAPMLDQAPKARKYFERLPGGGWTLRRT
KELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDN
RTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGAGA
QLPPQPRCLGRPPSPTSPPPPELMDVSLVGGPPDCSPPHPAPAPQHPAASALRTRMTGGR
PPLPPPDDPATLGPRLGLRGVPQSTAASS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccaccaggccatggtcccttctctggcttcccagggccccaggagcacacg
caggtattgcctgatgtgcggctgttgccacggaggctgcccttggcctttcgggatgcg
acctcagccccgctgcgcaagctgtccgtggacctcattaagacctacaagcacatcaat
gaggtatactatgcgaagaagaagcggcgggcccagcaggcgccacctcaggactcgagc
accaagaaggagaaaaaggtcctgaaccatggttatgacgatgacaaccacgactacatt
gtgcgcagtggcgagcgctggctggagcgctacgagattgactcactcattggcaaaggc
tcctttggccaggtggtgaaagcctatgatcatcagacccaggagctggtggccatcaag
atcatcaagaacaaaaaggccttcctgaaccaggcccagattgagctgcggctgctagag
ctgatgaaccagcacgacacagagatgaagtactacatagtgcacctgaagcggcacttc
atgtttcggaaccacctgtgcctggtgttcgagctgctttcctacaacctgtacgacctc
ctgcgcaacacgcacttccgcggagtctcgttgaacctgacgcggaagctggcgcagcag
ctctgcacagcgctgctcttcctggccacgcctgagctcagcatcattcactgcgacctc
aagcccgagaacatcctgctctgcaatcccaagcgtagcgccatcaagatcgtggacttc
ggcagctcctgccagcttggccagcggatctaccagtacatccagagccgcttctatcgg
tcgcctgaggtgcttctgggcacaccctacgacctggccattgatatgtggtccctgggc
tgcatcctggtggagatgcacactggagagcccctcttcagtggctccaatgaggtggac
cagatgaaccggattgtggaggtgctgggcatcccaccagcccccatgctggaccaggca
cccaaggctcgcaagtactttgaacggctgcctgggggtggctggaccctacgaaggaca
aaggaactcaggaaggattaccagggccccgggacacggcggctgcaggaggtgctgggc
gtgcagacgggcgggcccgggggccggcgggcgggggagccgggccacagccccgccgac
tacctccgcttccaggacctggtgctgcgcatgctggagtatgagcccgccgcccgcatc
agcccactgggggctctgcagcacggcttcttccgccgcacggctgatgaggccaccaac
acgggcccggcaggcagcagtgcctccacctcgcccgcaccccttgatacctgcccctcc
tccagcaccgccagctccatctccagctctggaggctccagcggctcctccagtgacaac
cggacctaccgatacagcaaccgatattgtgggggccccgggccccccatcactgactgt
gagatgaacagcccccaggtcccaccctcccagccgctgcgcccctgggcagggggtgat
gtgccccacaagacacatcaggcccctgcctccgcctcgtcactgccaggggccggggcc
cagttaccccctcaaccccgatgccttggccgtcccccatcaccaacctcaccaccaccc
ccggagctgatggatgtgagcctggtgggcggccctccggactgctccccacctcacccg
gcgcctgccccccagcacccggctgcctcagccctccggactcggatgacaggaggtcgt
ccacccctcccaccccctgatgaccctgccactctggggcctcgcttgggcctccgtggt
gtaccccagagcacggcagccagctcatga

DBGET integrated database retrieval system