KEGG   Felis catus (domestic cat): 101095249Help
Entry
101095249         CDS       T02385                                 

Gene name
PDIA6
Definition
protein disulfide isomerase family A, member 6
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101095249 (PDIA6)
Enzymes [BR:fca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101095249 (PDIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A3
AA seq 443 aa AA seqDB search
MVCFLSFTAGLISCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGH
CQRLTPEWKKVATALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGG
RTGEAIVDAALSALRQLVKDRLGGRGGGYGSGKQGRGESSTKKDVIELTDDSFDKNVLDS
EDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLAGRYGIRGF
PTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIIDEDIAKKTCEEHQLC
VVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELENALGIGGFGYP
AMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPAISTREPWDGKDG
ELPVEDDIDLSDVELDDLEKDEL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgctttttgtcttttactgcaggtctgataagctgtaccttctttctagcagtg
aatggtctctattcctctagtgacgatgtaattgaattaactccatcaaatttcaaccga
gaagttattcaaagtgatagtctgtggctcgtagagttctatgctccatggtgtggccac
tgccagaggttaacaccagaatggaagaaagtagcaactgcgctaaaagatgttgtaaaa
gttggcgcagttgacgcagataaacaccagtccctaggaggtcaatatggtgttcaggga
tttcctaccattaagatttttggatccaacaaaaacagaccagaagattatcagggtggc
agaactggcgaagccatcgtagatgctgctctcagtgctctgcgccagctcgtgaaggat
cgccttggggggaggggtggtggatatggttctggaaaacaaggtagaggtgagagttcg
actaagaaggatgtaattgagctgacggacgacagcttcgataagaatgtccttgacagt
gaagacgtttggatggttgaattttacgctccttggtgtggacactgcaaaaatcttgag
ccagaatgggctgctgcagccacagaggtaaaagagcaaaccaaaggaaaagtgaagctc
gcggctgtggacgccacggttaaccaggttctagccggccggtatgggattaggggattt
cctacaatcaagatatttcagaagggggaatctcctgtggattacgatggggggcggacg
cgatctgacatcgtctcccgggccctggatttgttttctgacaatgccccacctcctgag
ctgcttgagatcatcgacgaggacatcgctaagaagacctgtgaggagcaccagctgtgt
gtcgtggccgtgctgccccacatcctggacacgggagctgctggcagaaactcgtactta
gaagttcttcttaagttggcagacaaatacaaaaagaaaatgtgggggtggctgtggaca
gaagctggggcccaatctgaacttgaaaatgcgttggggatcggaggcttcgggtaccct
gccatggcagccatcaacgcacgcaagatgaaatttgctcttctgaaaggatctttcagc
gagcaaggcattaacgagtttctcagggagctctcttttgggcgcggatctacagcacct
gtgggaggtggggccttccccgccatcagcaccagagagccttgggacggcaaggatggc
gagcttcccgtggaagacgacattgacctcagcgacgtggagctggacgatttggaaaag
gatgagctgtga

DBGET integrated database retrieval system