KEGG   Felis catus (domestic cat): 101095266Help
Entry
101095266         CDS       T02385                                 

Gene name
DLST
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fca  Felis catus (domestic cat)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101095266 (DLST)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101095266 (DLST)
  Amino acid metabolism
   00310 Lysine degradation
    101095266 (DLST)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     101095266 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B3
AA seq 455 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPDSRKIVINNSSVFSVRF
FRTTAVCKDDVITVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPA
NGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPPEAPAAAAPKAEPTASAVPPPPAA
SIPTQMPPVPSPSQPLASKPVSAVKPTAAPPVAEPGAGKGLRSEHREKMNRMRQRIAQRL
KEAQNTCAMLTTFNEIDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVV
NAVIDDAAKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNYADIERAISELGEKARKNE
LAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYV
ALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcacgctgcgtgtctcgggcgttcagccgctcgttgtctgcttttcag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgtcagggacca
ggttaccctgacagcaggaagattgttattaacaacagtagtgtcttcagtgttcgcttc
ttcagaactacagctgtgtgcaaggatgatgtgattacagtcaaaaccccagcgtttgca
gaatctgtcacagagggagatgttaggtgggagaaagctgttggagacactgttgcagaa
gatgaagtggtttgtgagattgaaactgacaagacatctgtgcaggtcccatcaccagca
aatggcgtgattgaagcgcttttggtacctgatgggggaaaagtagaaggaggcactcct
cttttcacgctcaggaaaactggcgctgctcctgctaaggccaagccaccagaagctcct
gctgctgcagccccaaaagcagagcctacagcatcggcagttcctcctccccctgcagca
tccatacccactcagatgccaccagtgccctcaccctcacaacctctcgctagcaaaccg
gtgtctgcagtaaaacccactgctgcccctcccgtagctgagccaggagctggcaaaggt
ctgcgttcagaacatcgggagaaaatgaataggatgcgacagcgcattgctcagcgtctg
aaggaggcccagaatacgtgtgcgatgctgactacgttcaatgagattgacatgagtaac
atccaggagatgagggctcggcacaaagatgcttttctgaagaaacataacctcaaacta
ggcttcatgtcggcatttgtgaaggcctcagcctttgccttgcaggagcagcctgttgta
aatgcagtgattgacgacgcagccaaagaggtggtgtatagggattatattgacatcagt
gttgcggtagccaccccacggggtctggtggttcccgtcatcaggaacgtggaagctatg
aattatgcagatattgagcgagccatcagtgaactgggagagaaggcccgaaagaatgaa
cttgctattgaagatatggatggtggtactttcaccattagcaacggaggtgttttcggc
tcgctcttcggaacgcccatcatcaacccccctcagtcggccatcctgggcatgcatggc
atctttgataggccagtggctgtgggaggcaaggtggaggtgcggcccatgatgtatgtg
gcactgacctatgatcatcggctgatcgatggcagagaggcggtaacttttctccgcaaa
atcaaggcagcggtagaagatcccagagtcctcctcctggacctttag

DBGET integrated database retrieval system