KEGG   Felis catus (domestic cat): 101095268Help
Entry
101095268         CDS       T02385                                 

Gene name
KMT2D
Definition
(RefSeq) histone-lysine N-methyltransferase 2D
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00310  Lysine degradation
fca04934  Cushing's syndrome
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101095268 (KMT2D)
 Human Diseases
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    101095268 (KMT2D)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101095268 (KMT2D)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101095268 (KMT2D)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101095268 (KMT2D)
   HMT complexes
    MLL-HCF complex
     101095268 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box
Motif
Other DBs
NCBI-GeneID: 101095268
NCBI-ProteinID: XP_023112781
Ensembl: ENSFCAG00000000093
Position
B4
AA seq 5587 aa AA seqDB search
MDSQKPPGEDKDSEPAADGPAASEESGTTEPDLPNPHVGEVSVPSSGGPRLQEPPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPQCPVASPGGNPGPNEAALPCEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRRGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQPVSS
VAEQHPPVCSRFSPPEPGDTPTDEPEALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGAQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPP
EESPLSPPPESSPFSPLEESPFSPPEESPPSPPLETPLSPPPEASPLSPPFEESPLSPPP
EELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLS
PPPEASRLSPPPEDSPMSPPPEDSPMSPPPEVSCLSPLPEVSRLSPPPEESPLSPPPEES
PTSPPPEASRLFPPPEDSPASPPPEDSPASPPPEELLMTLPLEESSLLPLPEEPRLCPRP
EELCLSPRPEEPRLSPRPEEPRLSPRPEEPCLSPRPEEPRLSPALEEPRLSPAPEKLHLS
PPLEEPHLSPRPEKPCLSPAPEELCLSPRPEEPCLSPRPEEPRLSPRPEEPRLSPQPEEP
CLSPLPEEPQLSPVPEELRLSPGPEEPRLSPQPEEPPLSPRPEELRLSPQPEEPRLSPRP
EEPPEEPGLCPAAEELPLFLPPGEPPLSPLLGEPALSEPGEPPLSPLPEELPLSPSGEPS
LSPQLMPPDPLPPPLSPIITAVAPPALSPLGELEYPFGAKGDSDPESPLAAPILETPISP
PPEANCTDPEPVPPMILPPSPGSPMGPASPILMEPLPPQCSPLLQHSLPPQNSPPSQCSP
PALPLSIPSPLSPMEKAVEVSDEAEPHEMETEKVPEPECPALEPSPTSPLPSPMGNLSCP
APSPAPALDDFSGLGEDTAPLDGTDTPGSQPEAGQTPGSLASELKGSPVLLDPEELAPVT
PMEVYGPECKQAGQSSPCEEQEEPRAPVAPTPPTLIKSDIVNEISNLSQGDASASFPGSE
PLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTAIGGGKA
EGDKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSIETLVVADI
DSSPSKEEEDDDDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACSQCSQCY
HPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLDPPLLTV
PKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEEDLLIQCR
HCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVKPAAPVAPPELVPMKVKEPEPQY
FRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPDDKKDGD
LDADELLKGEGGVEHMECEMKLEGPVSPDIEPGREETEESKKRKRKPYRPGIGGFMVRQR
KSHTRVKKGPAAQAEVLSGDGQPDEVMPADLPAEGPVDQSLADGDEKKKQQRRGRKKSKL
EDMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGAPKAKGDSGSDRKELPTSQKGD
DAPDVADEESRGLEGKADTPGPEDGGIKASPVPSDPEKPGTPGEGMLSSDLDRIPTEELP
KMESKDLQQLFKDVLGSEREQHLGCGTPGSDGSRTPLQRPFLQGGLPLGNLPSSSPMDSY
PGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQ
RWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPATDKAPYLQKA
KDNRAAHRINKVQKQAESQINKQTKVGDMARKTDRPALHLRIPPQPGALGSPPPAAAPTI
FIGSPTTPAGLSTSADGFLKPPAGTVPGPDSPGELFLKLPPQVPAQVPSQDPFGLAPAYA
LEPRFPTAPPTYPPYPSPTGAPAQPLTLGASSRPGTGQPGEFHTTPPGTPRHQPSTPDPF
LKPRCPSLDNLAVPESPGIGGGKAAEPLLSPPPFGESRKALEVKKEELGASSPSYGPPNL
GFVDSPSSGPHLGNLELKAPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQALAPSSPS
HSDIFRPGPYPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQSSSQSP
LTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVAFKAGPL
AHTPLGAGGFPAALPSGPAGELHAKVPSGQPPNFARSPGTGAFVGTPSPMRFTFPQAVGE
PSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYAVATGNFHPSGSPLGSSSGSTGEG
FGLSPLRPPSVLPPPAPDGSLPYLSHGASQRAGITSPVDKREDPGAGLGSSLAAPELPGT
QDPGMSSLSQTELEKQRQRQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPGSWGAEP
SSPAFEQLNRGQTPFAGTQDKSSLVGLPPSKLGGPIMGPGAFPSDDRLSRPPPPATPSSM
DVSSRQLVGGSQAFYQRAPYPGSLPLQQQQQQQQQQLWQQQQQQQQATATSMRLAMSTRF
PSTPGPELGRQTLASPLAGIPARLPGPGEPVPGPAGPAQFIELRHNVQKGLGPGGAPFPG
QGPPQRPRFYPVSEDSHRMAPEGLRGLAVSGLPPQKPAAPPAPELNSSLHPVPHTKGPSL
PTGLELVSRPTSNTELGRPPPLALEAGKLPCEDPELDDDFDAHKALEDDEELAHLGLGVD
VAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLRLVESAN
EKAEREALLRGVEPGPMGPDERPLPAADVSEARLASVLPEVKPKVEEGGRHPSPCQFAIT
TPKVEPAPATTSLGLGLKPGQSVMGTRDTRMGTGPFSGSGHTTEKGPFGATGGPPAHLLT
PSPLSGPGGSSLLEKFELESGALTLPGGHAASGDELDKMESSLVASELPLLIEDLLEHEK
KELQKKQQLSAQLQPAQQQQQQQQQQQQQQHSLLATPGPAQAMSLTHEGSSPSLAGPQQQ
LALGLGGSRQPGLAQPLMPTQPPAHALQQRLAPSMTMVSSQGHMLSGQHGGQAGLVPQQS
PQPVLAQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAKAKMVAL
KGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPGSDLQNHVAAGSGQERSAGDPSQPRP
NPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKA
GREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQQQQHSA
VLALSPSQSPRLLTKLPGQLIPGHGLQPPQGPPGGQAAGLRLPPGGMALPGQPGGPFLNT
SLAQQQQQQHSGGTGALAGPSGGFFPGNLALRGLGPDSRLLQERQLQLQQQRMQLAQKLQ
QQQQQQHLLGQVAIQQQQQQSLGVQANQALGPKPPGLLPPSSHQGLLVQQLSPQPPQGPQ
GMLGPAQVAQQQQQHPGALGPQGPHRQVLLTQSRVLSSPQLAQQGQGLMGHRLVTAQQQQ
QQQHQQQGSMAGLSHLQQGLMPHSGQPKLSAQPMASLQQQQLQQQQLQQQQQQQQQLQQQ
QQQQQQQLQQQQQQLQQQQLQQQQQLQQQQLQQQQLQQQQQQQQQLQQQQQQQQQQQQQQ
QMGLLNQSRTLLSPQQQQQQQPVTLGPGIPAKPVQHFSNPGTLGPTVLLTGKEQSIVETA
LPPEATEGPSTHQGGPLAIGTIPESVATEPGEVKPSLSGDSQLLLVQPQAQPQPNPVQLQ
PPLRVPGQQQQQVNLLHTGGVGSHGQAGSGSSSEASSMPHLLAQSSVPLGEQPGTMTQNL
LGSQQPLGLERPVQNNAGPQPAKSGPVPQAGQGLPGAGVMPTVGQLRAQLQGVLAKNPQL
RHLSPQQQQQLQALLMQRQLQQSQSVRHAPPYQEPGAQPSPLQGLLGRQPQLGGFPGSQT
GPLQELGAGLRPQGPPRLPTPQGALSTGPVIGPVHPTPPPSSPQEPKRPSSQPPGASPLV
PSQLPSEAQLTPTQPGTPKPQGPSLELPPGRVSPAAAQLADTFFGKGLGPWDPPDNLVEA
QKPEQSIHLEQVNGQAVPEPPHLSIKQEPREEPCALGAQAVKREANGEPIGAPGTSNHLL
LAGPRSEAGHLLLQKLLRAKNVQLSTGRGPEGLRAEINGHIDSKLAGLEQKLQGTPSNKE
DTAARKPLTPKPKRVQKTSDRLVSSRKKLRKEDGVRASEALLKQLKQELSLLPLTEPTIT
ANFSLFAPFGSGCPVNGQCQLRGAFGSGALSTGPDYYSQLLTKNNLSNPPTPPSSLPPTP
PPSVQQKMVNGVTPSEELGEHPKDAASARDTEGTLRDTSEVKSLDLLAALPTPPHNQTED
VRMESDEDSDSPDSIVPASSPESILGEEAPRFPQLGSGRWEQDDRALSPVIPIIPRASIP
VFPDTKPYGALDLEAPGKLPATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVAVAELLSMK
IPNSYEVLFPESPARAGIEPKKGEAEGPGGKEKGLGGKSPEAGPDWLKQFDAVLPGYTLK
SQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLAPSPASPPA
EPLAELPAEPSAEPPVPSPLPLASSPESARPKPRARPPEEGEDSRPPRLKKWKGVRWKRL
RLLLTIQKAGGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGATDGPARLL
NLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATSSCNRMRCP
NVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEVKQIASIIQ
RGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTNNRRCCYRC
SIGENNGRPEFIIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLRLFPEYLKG
EELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSEPKILTHYK
RPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLARSRIQGLG
LYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPA
RYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAW
NCRKWMN
NT seq 16764 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagaagccgcctggtgaggataaagattcagaaccggcagctgatggacct
gcagcctctgaggagtcaggcaccactgagccagaccttcccaacccacatgtgggggag
gtctctgtgcccagttctggaggtcctaggcttcaggagcctccccaggactgcagtggg
ggtccggtgcggcgttgtgctctctgtaactgcggggagcccagtctacatgggcagcgg
gagctacggcgctttgagttgccatttgactggccccagtgtccagtggcgtcccctggg
gggaatccagggcccaacgaggcagcgctgccctgtgaggacctgtcacagattggtttc
cctgagggcctgacacctgcccacctaggagaacctggcgggtcctgctgggctcaccat
tggtgtgctgcgtggtcggcaggcgtatgggggcaggagggcccagaactatgtggtgtg
gacaaggccatcttctcagggatctcacagcgctgttcccactgcaccaggcgcggtgcc
tccatcccttgccgctcacccggatgtccacggctttaccacttcccctgtgcgactgcc
agcggttccttcttatccatgaaaacactgcagctgctatgcccggagcacagtgagggg
gctgcgcatctggaggaggctcgttgtgcagtatgtgagggaccaggggaattgtgtgac
ctgttcttctgtaccagctgtgggcatcactatcacggggcctgcctggacactgctctg
actgcccgcaaacgtgctggctggcagtgccctgaatgcaaagtgtgccaagcctgcagg
aaacctgggaatgactctaagatgttggtctgtgagacgtgtgacaaaggataccacacc
ttctgcctaaaaccaccaatggaggaactgcctgctcactcttggaagtgcaaggcatgc
cgggtatgccgggcctgtggggcaggctcagcagagctgaatcccaactctgagtggttt
gagaattactcgctctgtcaccgctgtcacaaagcccaaggaggacagcctgtcagttct
gtggctgagcagcatccccctgtctgtagcaggttctcacccccagagcctggtgatacc
cccactgatgagcccgaagctctgtacgttgcatgccaagggcagccaaagggtgggcac
gtgacctctatgcaacccaaggaaccggggcccctgcaatgtgaagccaaaccactaggg
agagcaggggcccaacttgagccccagttggaggcccccctaaatgaggagatgccactg
ctgcccccacctgaggagtcgcccctgtccccaccacctgaggaatcgcccacatccccg
ccgcctgaggcatcgcgcctgtccccaccacctgaggaatcacccctctctccaccgcct
gaggagtctcctctgtctcctccacctgagtcatcacccttttctccactggaggagtca
ccgttctctccaccagaggagtcccccccatctcccccactcgagacacccctgtctcca
ccgcctgaagcatcacccctgtccccaccatttgaagagtctcccctgtcccccccacct
gaggagttgcctacttccccacctcctgaagcatctcgcctgtctccaccacctgaggag
tcacctatgtcccctccacctgaagaatcacccatgtctccaccacccgaggcatctcgt
ctgttcccaccatttgaagaatcacccctatcccctccaccagaggagtctcctctctcc
ccaccaccagaggcatcacgtctgtccccaccacccgaggactcgcccatgtccccacca
cctgaagactcgcctatgtcccccccgcctgaggtatcatgcctatcccccctgcctgag
gtgtcacgcctgtccccaccgcctgaggaatctcccctgtccccaccgcccgaggagtct
cccacgtctcctccacctgaggcttcacgcctattcccgccgcctgaggactcacccgct
tccccaccacccgaagactcacctgcttctccgcccccggaggagctgctcatgacccta
ccgctagaggagtcatccttgttgccactgcctgaggagccacgactctgcccccgacct
gaggagctgtgcctgtcccctcggcctgaggagccgcgcctgtcccctcggcctgaggag
ccgcgcctgtcccctcggcctgaggagccctgtctgtccccccggcctgaggagccgcgc
ctgtcccccgcacttgaggaaccgcgcctgtcccctgcgcctgagaagctgcatttatcc
cctccgcttgaggagccacatctgtccccccggcctgagaagccatgcctgtcccctgcc
cctgaggagctgtgtctgtctccccggcctgaggagccctgtctgtccccccggcctgag
gagccacgcctgtccccccggcctgaggagccacgcctgtccccccagcctgaggagcca
tgcctgtcccccctgcctgaggagccgcagctgtcccccgtgcctgaggagctacgcctg
tcccccgggcctgaggaaccgcgcctgtccccccagcctgaggagccgcccctgtccccc
cggcctgaggagttgcgcttgtccccccagcctgaggaaccgcgcctgtcccctcgacct
gaagagccccctgaggagccaggcctatgccctgcagctgaggaattgcccttgttcctc
ccacctggggagccacctttatcccccttgcttggagagccggccctgtctgagcctggg
gaaccacctctgtcccctctacctgaggagttgccgttgtccccatccggggagccatcc
ttgtcacctcagctgatgccaccagatcctcttcctcctccactctcacccattattaca
gctgtggccccgccggccctgtctcctttgggggagttagagtacccctttggtgccaaa
ggggacagtgatcctgagtcgccgttggctgcccccatcctagagacacccatcagccct
ccaccagaagctaactgcactgaccctgagcctgtacctcctatgatccttcccccatct
ccaggctccccaatgggaccagcttctcccatcctgatggaaccccttccccctcagtgt
tctccactcctgcagcattccctgcctccccaaaactcccctccttcccagtgctctcct
cctgctctgccactgtccattccctccccactgagtcccatggagaaggcagtggaggtc
tcagatgaggctgagccacatgagatggagactgagaaagtcccagaacctgagtgccca
gccttggaacccagccctactagtcctctcccctcccccatgggtaacctttcctgccct
gcacctagtcctgccccggctctggatgacttctccggtctgggggaagatacagcccct
ctggatgggactgacactcctggttcacagccagaggctggacagacccctggcagtttg
gctagtgaacttaagggttcccctgtgctcctggaccccgaggagctggcccctgtgacc
cctatggaggtctatggcccagaatgcaagcaggcagggcagagttcaccctgtgaagag
caagaggagccacgtgcaccagtggcccctaccccacccactctcatcaaatccgacatc
gttaatgagatctccaatctgagccagggtgatgccagtgccagttttcctggctccgag
cccctgctaggctctcccgaccctgaagggggcggctccttgtccatggagctgggggta
tctacagacgttagtccagcccgagatgagggctccctgcgactctgtactgactcgctg
ccagagactgacgactcgctactgtgtgatgctgggacagctattggcggaggcaaagct
gagggggacaaggggaggcggcgcagctccccagctcgttcccgcatcaaacagggtcgc
agcagtagtttcccaggaagacgccggccacgtggaggagcacatggaggacgcgggaga
ggacgggcccggctaaaatcaactacttcttccattgagactctggtagttgctgatatc
gatagctctcccagcaaagaggaagaagacgacgatgatgacaccatgcaaaatactgtg
gttctcttctccaacacagacaagtttgtcctaatgcaggacatgtgcgtggtatgtggc
agctttggacggggagcagagggccacctcctcgcctgttcccagtgttctcagtgctat
cacccttattgtgtcaacagcaagatcaccaaggtgatgctgctaaagggctggcgttgt
gtggagtgcatcgtgtgtgaggtgtgcggccaggcctcggacccctcacgcctcctgctc
tgtgatgactgtgacattagctaccacacatactgcctggacccgccactgctcaccgtg
cccaagggtggctggaagtgcaaatggtgtgtgtcttgtatgcagtgtggggctgcctcc
cctggcttccactgtgaatggcagaatagttacacacactgcgggccctgcgctagcttg
gtgacctgccctatctgtcatgccccatatgtggaagaggacctcctaatccagtgccgc
cactgtgaacggtggatgcatgctggctgcgagagcctcttcacagaggatgacgtggaa
caggcggccgacgagggttttgactgtgtctcctgccagccttatgtggtaaagcctgct
gcacctgttgctcctccagagttggtgcctatgaaggtgaaagagccagagcctcaatac
tttcgctttgagggtgtgtggctgacagaaactggcatggctgtactgcgtaacctgacc
atgtcacccctgcacaagcggcgccagcggcgaggacggcttggcctcccaggggaggca
gggctagagggttctgagccctcagatgcccttggccctgatgacaagaaggatggggac
ctggatgctgacgagctgctcaagggtgaaggtggcgtggagcacatggaatgcgaaatg
aaactggaggggcctgtcagccctgatatagagcctggcagagaggagaccgaggaaagc
aagaaacgcaaacgcaaaccctatcggcctggcattggtggtttcatggtgcgacagcgg
aaatcccacacacgtgtgaaaaaggggcctgctgcacaggcggaggtgttgagtggggat
gggcagcccgacgaggtgatgcctgcagacctacctgcagagggccccgtggaccagagc
ttagctgatggggatgagaagaagaagcagcagcggcgtgggcgcaagaagagcaaactg
gaagacatgtttcctgcttatctgcaggaagccttctttgggaaggagctgctggacctg
agccggaaggccctttttgccgttggggtgggccggcccagttttggactaggagcccca
aaagccaagggggatagtggctcagataggaaggagctccccacgtcacagaaaggagat
gatgctccagatgttgcagatgaagaatcccgtggcctggagggcaaagcagatacacca
ggacctgaggatggaggcataaaggcatccccagtgcccagtgaccccgagaagccaggc
actccgggtgaagggatgcttagctctgacttagataggattcccactgaagaactgccc
aagatggaatctaaagacctgcagcagctcttcaaggatgttctgggttctgaacgagag
cagcacctgggttgtggaacccccggctcggacggcagccgtacaccgctgcagaggccc
tttcttcaaggtggactccctttgggcaatctcccctccagcagcccaatggactcctac
ccgggcctctgccagtccccattcctggattctagggagcgcgggggcttctttagcccg
gaacccggtgagccagacagcccctggacaggctcagggggcaccacgccctccaccccc
accacccccaccacggagggagagggcgacgggctctcctataaccagcggagccttcag
cgttgggagaaggatgaggagttgggccagctctccaccatctcacctgtgctctatgcc
aacattaactttcccaatctcaagcaagattacccagactggtctagccgttgcaaacaa
atcatgaagctctggagaaaagttccagctactgacaaagccccctacctgcaaaaggcc
aaagataaccgggcagctcaccgcatcaacaaggtgcaaaagcaggctgagagccagatc
aacaagcagaccaaggtgggcgacatggcccgtaagactgaccgaccggccctacatctt
cgcattcccccccagccaggggcactgggcagtccgccccccgctgctgcccccaccatt
ttcattggcagccccactacccccgccggcttgtctacctctgcggacgggttcctgaag
ccgccggcgggcacagtgcccggccccgactcgcccggtgagctcttcctcaagctccca
ccccaggtgcccgcccaagtgccttcgcaggacccctttggactggcccccgcctacgct
ctggagccccgcttccccacggcaccacctacttatcctccctatcctagtccaactggg
gcccctgcgcagcccctgacgctgggcgcctcatctcgtcctgggactggccagccaggg
gaattccacactaccccacccggcaccccccggcaccagccctccacacccgatcccttt
ctcaaaccccgctgcccctcactggacaacctggctgtgcctgagagcccagggataggg
ggaggcaaggctgccgagcccctgctgtcacccccgccttttggggagtctcggaaggcc
ctagaggtgaagaaggaagagcttggggcatcctctcctagctatgggcccccaaaccta
ggctttgttgactcaccttcctcaggcccccacctgggcaacctggagttaaaggcacct
gatgtctttaaagcccccctgacccctcgggcatctcaggtagagccccagagcccgggc
ttgggcctaaggccccaggagccaccccctgcccaggctttggccccttcttctcccagc
cactcggacatctttcgccctggcccctatcctgacccctatgcccagcccccgttgacc
cctcggccccaacccccaccccctgaaagctgctgtgccctgccccctcgctcattgccc
tcagaccctttctcccgagtacctgccagtccccagtcccagtccagctcgcagtcccca
ttaacaccccgtcctttgtctgctgaggctttttgcccatcccctgttacccctcgcttc
cagtctcctgacccttattcccgtccaccctcacgtcctcagtcccgtgacccatttgcc
cccttgcataagccaccccgaccccagccccctgaagttgccttcaaggctgggcctcta
gcccacactccactgggggctgggggcttcccagcagccctgccctcgggaccggcaggt
gagctccatgctaaggtcccaagtgggcagccccccaattttgcccggtcccctgggacg
ggtgcatttgtgggcaccccctctcccatgcgtttcactttccctcaggcggtaggggag
ccttccctaaagccccctgtccctcagcctggtctccctccaccccatgggatcaacagc
cattttgggcctggccctactttgggcaagcctcaaagcacaaactacgcagtagccaca
gggaacttccacccatcaggcagccccctgggatccagcagtgggtccacaggagagggc
tttgggctgtccccgctacgccccccatcagtcctaccaccacctgcaccggatggatct
ctcccctacctgtcgcatggagcctcacagcgggcaggcatcacctctccagtcgataag
cgagaagacccaggggctggattgggtagctctttggcggcacctgaacttccaggtacc
caggacccaggcatgtccagcctcagccagacagaactggagaagcagcggcagcgccag
cgactacgggagctcctgattcggcagcagatccagcgcaacaccctgcggcaagagaag
gaaacagctgcggcagctgcaggagcagtggggcccccaggcagctggggtgccgagccc
agcagccctgcctttgagcagctgaatcgaggccagactccctttgctgggacccaggac
aagagtagccttgtggggctgcccccaagcaaattgggtggccccatcatggggccaggg
gctttccccagcgatgaccgactctcccggccacctccaccagccaccccttcctctatg
gatgtgagcagccggcaactggtgggaggctcccaagccttctatcagcgagcaccctat
cctgggtccctgcccttacagcagcagcagcagcagcagcagcaacaactgtggcagcag
cagcagcaacaacagcaggcaacagcaacctccatgcgccttgccatgtctactcgcttt
ccatcaactcctgggcctgaacttggccgccaaaccctagcttcccccttggcaggaatt
cccgcccgcctccctggccctggagagccagtgcctggtccagctggtcctgcccagttc
attgagttgcggcacaatgtacagaaaggactaggacctgggggggctccgtttcctggg
cagggcccccctcagagaccccgtttttacccagtaagtgaggactcccaccgaatggct
cctgaagggcttcgaggcctggcagtatcaggccttcccccacagaaacccgcagcacct
ccggcccctgaattgaacagtagtctccatccagtgccccacaccaaaggtccctccctg
cccactggcttggagctggtcagccggcccacctcaaacactgagcttggccgccctcct
cctctggccctggaagctgggaagttaccctgtgaggatcctgagctggacgatgacttt
gatgcccacaaggccctagaggatgatgaggagcttgctcacctgggcctgggtgtggat
gtggccaagggagatgatgagctgggcaccttggaaaacctggagaccaatgaccctcac
ctggatgacctgctcaatggggatgagtttgatctgctggcctatactgaccctgagctg
gatactggggacaagaaggacatcttcaatgagcacctgaggctggtagagtcggccaat
gaaaaggctgagcgggaggccctgctgcggggggtggagccaggacccatgggccctgat
gagcgccctctgcctgctgctgatgtctctgaggcccgtctggcatcggtgctccctgag
gtgaagcccaaggtagaggaaggtgggcgccacccttccccttgccagttcgccattacc
acccccaaggtagagccagcacctgccaccacttccctaggtctagggctgaaaccagga
cagagtgtgatgggcacccgggacacccggatgggcacaggacccttttccggcagtggg
cacacaactgagaagggcccctttggggccacaggaggaccaccagctcacctgctgaca
cccagcccgctgagtggcccaggagggtcctccctgctggaaaagtttgagctggagagt
ggggccctgaccttgcccggtggacatgcagcatcaggggatgagctggacaagatggag
agctcgctggtagccagtgagttacccttgctcatcgaagacctgttggagcatgagaag
aaggagctgcagaagaagcagcagctttcggcacagctgcagcctgcccagcaacagcag
caacaacagcagcagcagcagcagcagcagcattccctgctggccacaccaggccctgcc
caggccatgtctttgacacatgaaggctcttctcccagtttggctgggccccaacagcag
cttgccctaggacttgggggttcccgacagccaggcttggcccaaccactgatgcccacc
cagccaccagcacatgccctccagcagcgcctggccccatccatgaccatggtgtccagt
caaggacatatgctaagtgggcagcacggggggcaggcaggcttggtgccccagcagagc
ccacagccagtgctggcacagaagcccatgggtaccatgccaccttccatgtgtatgaaa
cctcagcagctggccatgcagcagcagctggctaacagcttcttccctgatacagatctg
gacaaatttgcagcagaagatatcattgatcccattgcaaaggccaagatggtggcttta
aaaggcatcaagaaagtgatggctcagggcagcattggagtggcacctggtatgaacagg
cagcaagtatctctgctagcccagaggctctcaggggggcccggcagtgatctgcagaac
cacgtggcagctgggagtggccaggagcggagtgctggtgacccttcccagcctcgtccc
aatccacccacctttgcccagggagtgatcaatgaggctgaccagcggcagtatgaggaa
tggctgtttcatacccagcagctcctacagatgcagctgaaggtgctagaggagcagatc
ggtgtgcatcgcaagtcccggaaggctctgtgtgccaaacagcgcactgccaagaaggct
ggccgtgagttcccagaagctgatgctgagaagctcaagctggttacagagcagcagagc
aagatccagaaacagctggatcaggtccggaagcagcagaaggagcacaccaacctcatg
gcagaatatcggaataagcagcagcaacagcagcaacagcagcaacagcaacactcagct
gtgctggccctcagcccttcccagagtccccggctactcaccaagctccccggtcagctg
atccctggccatgggctgcagccaccacagggccctccgggtgggcaagctgcgggtctt
cgcctgcccccagggggcatggctctccctggacagcctggtggcccttttctcaacacc
tccctggcccagcagcagcaacagcaacattctggtgggactggggccttggctggcccc
tcagggggctttttccctggcaaccttgctcttcgaggcctaggacctgattcgagactt
ttacaggagaggcagctacagctccagcagcagcgcatgcaactagcccagaaattgcag
cagcagcaacagcaacagcacctcctaggacaggtggcaatccagcagcaacagcagcag
agcttgggggtacaggcaaaccaggctctgggtcccaagcctccggggcttctgcctccc
agtagccatcaaggcctcttggtccagcagctgtccccgcaaccaccccaggggccccag
ggcatgctgggccctgcccaggtggcacagcagcagcagcagcaccctggagctttgggg
ccccagggtcctcacagacaggtacttcttacccagtcccgggtgctgagttccccccag
ctggcacagcagggtcagggccttatgggacaccggctggtcacagcccagcagcagcag
cagcaacagcaccaacagcagggatccatggcaggcctttcccatcttcagcagggcctg
atgccacacagcgggcagcccaaactgagtgctcagcccatggcttccttacagcagcag
cagcttcagcagcagcagctacagcagcaacaacagcagcagcagcagctacagcagcaa
caacagcagcagcaacagcagctacagcagcagcagcagcagctacaacagcagcagctg
cagcagcagcaacaactacaacaacagcaactacagcagcagcagctacagcagcagcag
caacagcaacaacaattgcagcagcagcaacagcagcagcagcagcagcagcaacagcag
cagatgggcctcttgaaccagagtcgaactttattgtctccccagcagcagcagcagcag
cagccagtgacccttggccctggcataccagccaagcctgtgcaacacttttctaacccc
ggaaccctgggcccaactgtcctcttgacgggcaaggaacaaagcattgtagagacagct
cttcctccagaggccactgaggggccctccacacatcagggagggccgttagcaataggg
actatacctgagtcagtggcgaccgaacctggggaggtaaagccttcgctctccggggac
tcacagctcctgcttgtccagccccaggcccagcctcagcccaaccctgtgcagctgcag
ccacctctgagggtcccagggcaacagcagcagcaagttaacttgctccacacaggaggt
gtgggaagccatgggcaagcaggcagcggatcatcttctgaggcctcatctatgccccat
ctgctggcccaatcctctgttcctttaggggagcagcctgggaccatgacccagaacctt
ctgggttcccaacaaccccttggactagagcggccagtgcagaataatgcagggccacag
cctgccaaatcaggacctgtcccccaggctgggcagggcctgcccggggctggcgtcatg
cctacggtgggtcagcttcgagcacagctccaaggagtcctggccaaaaacccccagctg
cggcacttgagtccacagcagcagcagcagctacaggcgctcctcatgcagcggcagctg
cagcagagtcagtcagtgcgccatgccccaccctaccaggagcctggggcccagccctct
ccccttcagggcctcctaggccgccagcctcaacttgggggctttcctggatcccagact
ggccccctccaggagctaggggcagggcttcgacctcagggcccaccccggctccccacc
ccacaaggagccttatccacaggaccagtcattggccctgtccatcccacacctccacca
tccagcccccaagagccaaagagaccttcctcacagcccccaggagccagccccctggtc
ccatcccagctcccctctgaggcccagctcacccccacccagccagggactccaaaaccc
cagggcccatccttggagctgcctcctgggagggtctcacctgctgctgcccagcttgca
gataccttctttggcaaggggctgggaccttgggaccccccagacaacctagtggaagcc
cagaagccagagcagagcattcatctggagcaggtgaatgggcaggcagtgcctgagcca
ccccatctcagcatcaagcaggagcctcgggaagagccatgtgccctgggagcccaggcg
gtgaagagggaggccaacggggagccaataggggcaccaggtaccagcaaccacctcctg
ctggcaggcccccgctcagaggccgggcatctgctcttgcagaagcttctacgggcaaag
aatgtgcaactcagcactgggcgggggcccgaggggctgcgagctgagatcaacgggcac
attgacagcaagctggctgggctggagcagaaactacagggtacccccagcaacaaggag
gatacagcagcaaggaagcctttgacaccaaagcccaagcgggtacagaagacaagcgac
aggttggtgagctcccgaaagaagctgcggaaggaggacggggtcagggccagcgaggcc
ttgctgaaacagctgaaacaggagctgtccctgctgcccttaacggagcctaccatcacc
gccaattttagcctctttgctcccttcggcagtggctgcccggtcaatgggcaatgccag
ctgaggggggcctttggaagtggggcgctgtccacgggccctgactactattcccagctg
cttaccaagaataacctgagtaacccgccgacaccaccctcgtcgctgccccccacccca
cccccatcggtgcagcagaagatggtgaatggcgtcactccatctgaagagctgggggag
caccccaaggatgctgcctctgcccgggatactgaagggacactgagggatacttcagag
gtgaagagtctagacctgctggctgccttgcctacaccccctcacaatcagactgaggat
gtcaggatggagagtgacgaggacagcgattctcctgacagcattgtgccggcttcgtcc
cccgagagcatcctgggggaggaggcccctcgtttccctcagctcggctcaggccggtgg
gagcaggatgaccgggctctctcccctgtcatccccatcattcctcgggccagtatccca
gtcttcccagataccaaaccttatggggccctggacctggaggcccctggaaagctgcct
gccacaacttgggaaaagggcaaaggaagtgaggtgtcagtcatgctgacggtctctgct
gctgcagccaagaacctgaatggtgtgatggtggcggtggcagagctgctgagcatgaag
atccccaactcctatgaggtgctgttcccagagagccctgcccgggcaggcattgagcct
aagaagggggaagccgagggccctggagggaaagaaaagggtctgggaggcaagagccca
gaagctggccctgattggctgaaacagtttgatgcagtgttgcctggctataccctcaag
agccagctagacatcttgagcctcctgaaacaggagagccctgccccagagccacccacc
caacacagctacacctacaacgtctccaacctggatgtgcgacagctctcagccccgcct
cctgaagaaccctccccgcccccatcccccttggcaccctctcctgccagcccccctgct
gaacccctggctgaactcccggctgaaccctcagctgagccacctgtcccctcgcctctg
ccactggcctcatcccctgaatcagcccgacccaagccccgagcccggccccctgaagaa
ggtgaagattcccggccccctcgcctcaagaagtggaagggggtgcgttggaagcggctg
cggctgctgctgaccattcagaaggccggtggacggcaggaggatgagcgggaagtggcg
gagtttatggaacagctcggcacagccctgcgacccgacaaggtgcctcgcgacatgcgg
cgctgctgcttctgtcacgaggagggtgatggggccactgatggacctgcccgcctgctg
aacctggacctggacctgtgggtgcacctcaactgcgctctgtggtccacggaggtatac
gagacccagggcggggcactgatgaacgtggaggttgccctgcaccgaggactgctcacc
aagtgctccctgtgccagcgcaccggtgccaccagcagctgcaatcgaatgcgttgtccc
aacgtctaccattttgcctgtgccatccgcgccaagtgcatgttcttcaaggacaagacc
atgctgtgtccaatgcataagatcaagggaccctgtgagcaggagctgagctcttttgct
gtcttccggcgggtctacattgagcgggatgaggtgaagcaaatcgccagcatcatccag
cggggagagcggctgcacatgttccgtgtagggggccttgtgttccatgccattggacag
ctgctccctcaccaaatggccgacttccacagtgccactgccctttatcctgtgggctat
gaggccacacgcatctactggagcctccgcaccaacaaccgccgctgctgctaccgctgc
tccatcggcgagaacaacggaaggcccgagttcataatcaaagtcatcgagcagggcctg
gaggacctggtcttcaccgacgcctccccccaggctgtgtggaatcgcatcattgagcct
gtggctgccatgagaaaagaggccgacatgctgcggctcttccctgagtacctgaaaggc
gaggagctctttgggctgacggtgcacgccgtgctgcgcatagctgaatcactgcctgga
gtggagagctgtcaaaactatttattccgctatggacgccaccccctgatggagctgcca
ctcatgatcaatcccactggttgtgcccgatcggagcctaaaatcctcacacactacaaa
cggcctcacaccctgaacagcaccagcatgtccaaggcgtatcagagcaccttcacaggc
gagaccaacaccccatacagcaagcagtttgtgcactccaagtcatcacagtaccggcgt
ctgcgcactgagtggaagaacaatgtgtatctggctcgctcccgtatccagggcctgggg
ctctatgccgccaaggacctagaaaagcacacgatggtcattgagtatattggcaccatc
attcgcaacgaggtggccaaccggcgggagaaaatctatgaggagcagaatcgaggcatc
tacatgttccgaataaacaatgaacatgtgattgatgctacgttgaccggaggtcctgcc
aggtacattaaccattcctgtgcccctaactgtgtggcggaagttgtgacgtttgacaag
gaggataaaatcatcatcatctccagccggcgaatccccaaaggagaggagctgacctat
gactatcagtttgactttgaggacgatcagcacaagatcccctgccactgtggagcctgg
aattgtcgaaaatggatgaactaa

DBGET integrated database retrieval system