KEGG   Felis catus (domestic cat): 101095275Help
Entry
101095275         CDS       T02385                                 

Gene name
USP24
Definition
(RefSeq) ubiquitin specific peptidase 24
  KO
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101095275 (USP24)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101095275 (USP24)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101095275 (USP24)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
C1
AA seq 2588 aa AA seqDB search
MENTERREESLALRFEKLQYLMARKRGCDREEAVGDPHSPRGATAGHASPLCSTYTHCHA
VTDASACVFAVIPVCQKNDENGNCSGEGIEFPTTNLYELESRVLTDHWSIPYKREESLGK
CLLASTYLARLGLSESDENCKRFMDRCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLI
ELVAERIKQDPIPTGLLGVLTMAFNPDNEYHFKNRMKTSQRNWTEVFGEGNMFAVSPVST
FQKEPHGWVVDLVNKFGELGGFAAIQAKLHSEDIELGAVSALVQPLGVCAEYLNSSVVQP
MLDPVILTAIQDVRSVEEKDLKDKRLVSIPELLSAIKLLCMRFQPDLVTVVDDLRLDILL
RMLKSPHFSAKMNSLKEVTKLIEDSTLSKSVKNAIDTDRLLDWLVENSVLSIALEGNIDQ
AQYCDRIKGIIELLGSKLSLDELTKIWKIQSGQSSTVIENIHTIIAAAAVKFNSDQLNHL
FVLIQKSWETESDRVRQKLLSLIGRIGREARFETTSGKVLDVLWELAHLPTLPSSLIQQA
LEEHLTILSDAYAVKEAIKRSYIIKCIEDIKRPGEWSGLEKNKKDGFKSSQLNNPQFVWV
VPALRQLHEITRSFIKQTYQKQDKSIIQDLKKNFEIVKLVTGSLIACHRLAAAVAGPGGL
TGSTLVDGRYTYREYLEAHLKFLAFFLQEATLYLGWNRAKEIWECLVTGQDVCELDREMC
FEWFTKGQHDLESDVQQQLFKEKILKLESYEITMNGFNLFKTFFENVNLCDHRLKRQGAQ
LYVEKLELIGMDFIWKIAMESPDEEIANEAIQLIINYSYINLNPRLKKDSVSLHKKFIAD
CYTRLEAASSALGGPTLTHAVTRATKMLTATAMPTVATSVQSPYRSTKLVIIERLLLLAE
RYVITIEDFYSVPRTILPHGASFHGHLLTLNVTYESTKDTFTVEAHSNETIGSVRWKIAK
QLCSPVDNIQIFTNDSLLTVNKDQKLLHQLGFSDEQILTVKTSGSGTPSGSSADSSTSSS
SSGSGAFSSSYAMEQEKSLPGVVMALVCNVFDMLYQLANLEEPRITLRVRKLLLLIPTDP
AIQEALDQLDSLGRKKTLLSETSSQSSKSPSLSSKQQHQPSASSILESLFRSFAPGMSTF
RVLYNLEVLSSKLMPTADDDMARSCAKSFCENFLKAGGLSLVVNVMQRDSIPSEVDYETR
QGVYSICLQLARFLLVGQTMPTLLDEDLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEK
SSYRQLSVSDRSSIRVEEIIPAARVAIQTMEVSDFTSTVACFMRLSWAAAAGRLDLVGSS
QPIKESNSLFPAGIRNRLSSSGSNCSSGSEGDPAALHAGICVRQQSVSTKDSLIAGEALS
LLVTCLQLRSQQLASFYNLPCVADFIIDILLGSPSAEIRRAACDQLYTLSQTDTSAHPDV
QKPNQFLLGVILTAQLPLWSPTSIMRGVNQRLLSQCMEYFDLRCQLLDDLTTSEMEQLRI
SPATMLEDEITWLDNFEPNRTAECETSEADNILLAGHLRLIKTLLSLCGAEKEMLGSSLI
KPLLDDFLFRASRIILNSHSPAGSAAISQQDFHPKCSTVNSRLAAYEVLVMLADSSPANL
QIITKELLSMHHQPDPALTKEFDYLPPVDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPG
LPESLLSVDDDTDNPDDSVFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQ
DAYEFFTSLIDQMDEYLKKMGRDQIFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGV
TSCQSLEISLDQFVRGEVLEGSNAYYCEKCKEKRITVKRTCIKSLPSVLVIHLMRFGFDW
ESGRSIKYDEQIRFPWMLNMEPYTVSGMARQDSSSEVGENGRSMDQGGGGSPRKKVALTE
NYELVGVIVHSGQAHAGHYYSFIKDRRGCGKGKWYKFNDTVIEEFDLNDETLEYECFGGE
YRPKVYDQTNPYTDVRRRYWNAYMLFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPS
SPEISPQSSPRPHRPNNDRLSILTKLVKKGEKKGLFVEKMPARIYQMVRDENLKFMKNRD
VYSSDYFSFVLSLASLNATKLKHPYYPCMAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWI
ATIEALLSKSFDACQWLVEYFISSEGRELIKIFLLECSVREVRVAVATVLEKTLDSALFY
QDKLKSLHQLLEVLLALLDKDVPENCKNCAQYFFLFNTFVQKQGIRAGDLLLRHSALRHM
TSFLLGANRQNNQIRRWSSAQAREFGNLHNVVALLVLHSDVSSQRNVAPGVFKQRPPISI
APSSPLLPLHEEVEALLFLSEGKPYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFT
MLHFIKNQLETAPPHELKNTFQLLHEILVIEDPIQVERVKFVFETENGLLALMHHSNHVD
SSRCYQCVKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETST
GKTFQRTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGERHLQQGSESPMMIGELR
SDLDDVDP
NT seq 7767 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaccgagaggagagaagagagcctagcgctgaggtttgagaagctccagtat
ttgatggccaggaagaggggatgtgaccgtgaggaagccgtaggggatccacactcccca
cggggcgctaccgctgggcatgcatctccgctgtgctcaacatacacgcattgtcacgca
gtcactgatgcgtctgcttgtgtttttgccgtcatccctgtttgtcagaagaatgatgaa
aacggaaactgctcgggggaagggatcgagttccccaccacaaatctgtacgagctggaa
agccgcgttttgaccgatcactggtccatcccctacaagcgggaagaatcactgggcaaa
tgcctgttggcgtccacctacctggccagactcggtctttccgagtctgatgagaattgt
aaaagatttatggataggtgtatgcctgaagcatttaaaaagctcctgacatcaagtgct
gttcacaagtggggtactgaaattcatgaaggaatctacaacatgttgatgctattaata
gaactggttgcagagagaattaaacaagatccgattcccacaggtctcctgggtgtgctt
acgatggctttcaatcccgataatgagtaccattttaaaaacagaatgaaaacatctcaa
aggaattggacagaagtgtttggggagggaaatatgtttgctgtttcacctgtgtctact
ttccaaaaggagcctcacggatgggttgtggatttggtaaataagtttggagaattaggc
ggatttgcagcaatccaagccaagcttcattcggaagatatagaacttggggcggtctca
gcattggtgcagcccttgggggtgtgtgcggagtacctcaattcctcggtggttcagccg
atgctagacccagtcatccttactgcgatccaggatgtacggagcgtggaggaaaaggac
ctcaaagataagagattggttagcatccccgagctcttgtctgccatcaagttactctgc
atgcgcttccagccggatttggtgaccgtggtggatgaccttcgattagacatcctactg
cgcatgctgaagtcgccacattttagcgctaaaatgaattccctcaaagaagtaaccaaa
ctaatagaagatagcactttatccaaatctgtgaagaatgctatagatacagacagattg
ttagattggctggttgaaaactcagttctgtccattgcactggaaggcaacatagaccaa
gcacaatactgtgatcgtataaaggggattattgaactcttgggcagtaaattgtcttta
gatgaacttactaaaatttggaagatacagtcgggacaatcatctactgtgatcgagaac
atccatactattattgctgcagcagctgtcaaatttaattcagatcagcttaatcatttg
tttgttctcattcagaagagctgggagacggaaagcgatagagtaagacagaagctgttg
agcctgattggacgaataggccgggaagctcgctttgagaccacgtctggaaaggtgtta
gatgtactctgggaactggcccatcttccgaccctgcccagtagccttatccagcaagcc
ctggaggagcacctgacgatcctgagtgacgcatacgcggtgaaggaagcaatcaagaga
agctacatcattaagtgcatagaagatattaaaaggcccggagagtggtcaggtttggaa
aaaaacaagaaggacggattcaagtcgtctcagcttaacaatccccagtttgtgtgggtg
gtgccagccttgcgtcagctccacgagatcacccgctcgttcataaaacagacctatcaa
aagcaagacaagagcatcattcaagacttgaagaaaaattttgaaatcgtgaagttggtg
accggaagtttgatagcttgtcatcgactcgcagccgctgtggctggacccggaggcctg
actggttccacgctggtggatggccgatacacttaccgggagtatttagaggcccatcta
aaatttctagcgtttttcttgcaagaagccactctgtatctgggttggaatcgtgccaag
gaaatctgggagtgtcttgtgactggccaggatgtttgtgaattggatcgagagatgtgt
tttgaatggtttacaaaaggccaacatgatctcgagagtgacgttcagcagcagcttttc
aaggagaaaattcttaaattggagtcatatgaaatcaccatgaatgggtttaacttgttt
aagactttttttgaaaatgtgaatctttgtgatcatcgattgaaacgacaaggagctcag
ttgtatgtagaaaagctggaattgataggaatggatttcatttggaaaatagccatggaa
tcacctgatgaagaaattgctaatgaagctattcagttaatcataaactatagttacatt
aatctaaatcccagattgaagaaggattccgtatcgttacataagaaatttattgctgat
tgttacacgagattagaagcagccagctcagcacttggtggccccactctgacgcatgca
gtgaccagagcaacaaaaatgcttacggcaactgctatgccaaccgtagcaacatccgtt
cagtctccatatagatccaccaaacttgtaataatcgagagactgctgcttttggcagaa
cgctatgtgatcactatagaggatttttactctgttccacgaactattctacctcatggt
gcctcatttcatggacatcttttaactctcaacgtcacgtatgagtctaccaaagatacc
ttcactgtagaggctcacagtaatgaaaccatagggagcgtgcgatggaagatagccaag
cagttgtgctcacctgtggacaacatacagatatttacgaacgatagcctgctgaccgtg
aataaagatcaaaagctcctccaccagctgggcttttctgatgaacagatcctcacggtg
aagacttcgggcagcgggaccccatccggcagctccgcggactcctcgaccagctccagc
agcagcggcagcggggcctttagctcatcgtacgccatggagcaggagaagtccctccct
ggtgttgtgatggcacttgtatgtaatgtgtttgacatgctttaccagctggccaatctg
gaggagccaaggataactctacgcgtacgaaagcttctcctgttgatacccactgaccca
gccattcaggaagccctggatcaacttgattctttaggaagaaagaaaacattactgtcc
gaaacgagttctcagtcctcaaagtctccatccctgtcctcaaagcagcagcatcagcca
agcgccagctcgattttggaaagtctgtttcgctcttttgctccgggaatgtccaccttc
cgagtgctctacaacttagaagttctgagctccaaactcatgccaacagctgatgatgac
atggcaaggagttgtgcgaaatccttctgtgagaacttcctcaaagcaggagggttgagt
ttggttgtaaatgtcatgcagagggattccatcccttcagaagtagactatgaaacaagg
cagggagtttactccatctgcctacagcttgcaagattcttacttgttgggcaaacaatg
cccacgttgttagatgaagacctcaccaaagatggcatagaagcactttcttctcgccca
ttccgaaacgtcagccggcagacaagcaggcagatgtccttgtgtggtaccccagagaag
tcctcctaccgacagttgtccgtgtccgacaggtcttctatcagggtcgaggagatcatc
cctgctgcgcgagttgcgatacaaacaatggaagtaagtgacttcacgtctactgtggct
tgtttcatgaggttgtcgtgggctgcggctgcaggacgactggacctcgttgggagtagc
cagccaattaaagaaagcaattctctgtttcctgctggaattcgaaacagactcagcagc
tcaggaagcaattgcagctctgggagcgaaggggacccagcagccctgcacgcaggcatc
tgtgtgcgccagcagtctgtgtccaccaaagactccctgatcgccggggaggctctctct
cttcttgtcacgtgcctgcagcttcggagccagcaactggcatctttctataacttgccc
tgtgttgccgattttatcattgatattctgcttggatcaccaagtgctgagattcgccgt
gctgcctgtgatcaactatacactcttagtcagacagatacttcagctcatccagatgtc
cagaagccaaaccagtttctcctaggtgtgattctcacagcccagctacctctctggtcc
ccaactagtataatgagaggagtcaatcagagactactatctcagtgtatggagtatttt
gatctaaggtgccaattattagatgatctgacaacctcagaaatggagcagttaagaatc
agcccggctaccatgctcgaagatgagatcacttggctggataactttgagcctaatcgc
acggctgaatgtgagaccagtgaagcagacaacatcttattggcaggacacctacggctc
attaagacccttctttcactgtgcggggcagagaaggaaatgcttggttcatcactcatt
aaaccattgttagatgacttccttttccgagcttctagaattattttaaatagtcattct
ccagctggcagtgccgccatcagtcaacaggactttcatccaaagtgtagtacagtgaat
agccgactggcagcctatgaagtccttgtgatgctggctgatagttccccggcaaatctt
caaattatcacaaaagaactgctttccatgcatcatcagcctgaccctgctctcaccaag
gagtttgattatcttccccctgtggatagcaggtccagctcagggtttgtggggctgagg
aatggcggcgctacgtgttacatgaatgcagtcttccagcaactgtatatgcagcctggt
ctgcctgagtcgttactttcagtagatgatgacacagacaatccagacgacagcgtattc
taccaggtgcagtctctctttgggcatttgatggaaagcaagctgcagtattatgtacct
gagaacttctggaagattttcaagatgtggaacaaagaactttatgtgagagagcagcag
gatgcatatgaattcttcactagtcttattgatcagatggacgaatatctcaagaaaatg
gggagagaccagatttttaagaatactttccagggcatctattctgaccagaagatctgt
aaagactgtcctcacagatatgagcgtgaggaagctttcatggccctcaatcttggagtt
acttcttgtcagagcttggaaatttctttggaccagtttgttagaggagaagttctagaa
ggaagtaatgcatattactgcgaaaagtgtaaagaaaagagaataactgtgaaaaggacc
tgcattaagtctttacctagcgtcttggtaattcacctaatgagatttggatttgactgg
gagagtggacgctccattaaatatgacgaacagataaggtttccctggatgctaaacatg
gagccctacacagtttcaggaatggctcgccaggattcgtcttctgaagttggtgaaaac
gggcgaagtatggaccagggaggtggaggatccccacgaaaaaaagttgccctcactgaa
aactatgaacttgtcggtgtcattgtccacagtgggcaggcacatgcgggtcactactat
tccttcattaaggaccgacgggggtgtggaaaaggaaaatggtacaagtttaatgacaca
gtcatagaagaatttgacctaaatgatgagaccctggagtacgaatgctttggaggagaa
tatagaccaaaagtttatgatcaaacaaacccgtatacagatgttcgccgaagatactgg
aatgcctatatgctcttctaccaaagggtctctgatcaaaactccccagtattaccaaag
aagagtcgagtcagtgtggtacggcaggaagctgaggatctctctctgtcagcaccgtcc
tcaccggaaatttcacctcagtcctcccctcggccccataggcctaacaatgaccggctc
tctattctaaccaagctggttaaaaaaggtgagaagaaagggctatttgtggagaaaatg
cctgctcgaatataccagatggtgagagatgaaaacctcaagtttatgaagaatagagat
gtatacagtagtgattatttcagttttgttttgtctttagcgtcactgaatgctactaaa
ttaaagcatccatattatccttgcatggcaaaggtgagcttacagcttgcaattcagttc
ctttttcaaacttatctacggacaaagaaaaaactcagggttgatactgaagaatggatt
gccactattgaagcattactttccaaaagttttgatgcttgtcagtggctcgttgaatat
tttattagttctgaaggacgagaattaataaagattttcttgctggagtgcagcgtgcga
gaagtgcgagttgccgtggccaccgttctggagaaaaccctagacagtgccttgttttat
caggataagttaaaaagccttcatcagttactggaggtcctacttgctctgttggataag
gatgtcccagaaaactgtaaaaactgtgctcagtactttttcctattcaacacttttgta
caaaagcaaggtattcgggctggggatcttcttctgaggcactcagctctgcgacacatg
accagctttctcctcggggccaaccggcaaaacaatcagatacgtcggtggagttcagca
caagcacgagaatttgggaatcttcacaatgtagtggcgttacttgttttgcattcagat
gtctcttcccaaaggaacgttgctcctggtgtatttaaacaacggccacctattagcatc
gccccctccagccctctgctgcccctccatgaggaagtagaagccttgttgttcttgtct
gaagggaagccttacctgttagaggtgatgtttgctttgcgagagctgacgggctcgctc
ctggcgctcatcgagatggtcgtgtactgctgcttctgtaacgagcacttctccttcacc
atgctgcacttcattaagaaccaactagaaacggctccaccccatgagttgaagaatacg
ttccagctcctccatgagatactggtcattgaagatcccatacaggtggagcgagtcaaa
tttgtgtttgagacagaaaatggattattagctctgatgcaccacagtaatcacgtggac
agcagtcgctgctaccagtgtgtcaaattcctcgtgactcttgctcaaaagtgtcctgct
gctaaggaatacttcaaggagaattcccaccactggagttgggctgtacaatggctacag
aagaagatgtcagaacattactggactccacagagtaacgtctctaacgaaacatcaact
ggaaaaaccttccagcggacgatttcagctcaggacaccctggcgtatgccacagctctg
ctgaatgagaaagagcagtccgggagcagtaacggctcggagagcagtcccgcgaacgag
aacggggagaggcatttacaacagggttcagagtcacccatgatgattggcgagttgaga
agcgacctggacgatgtcgacccctaa

DBGET integrated database retrieval system