KEGG   Felis catus (domestic cat): 101095275Help
Entry
101095275         CDS       T02385                                 

Gene name
USP24
Definition
ubiquitin specific peptidase 24
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 2523 aa AA seqDB search
MMGAHGGGESKKNDENGNCSGEGIEFPTTNLYELESRVLTDHWSIPYKREESLGKCLLAS
TYLARLGLSESDENCKRFMDRCMPEAFKKLLTSSAVHKWGTEIHEGIYNMLMLLIELVAE
RIKQDPIPTGLLGVLTMAFNPDNEYHFKNRMKTSQRNWTEVFGEGNMFAVSPVSTFQKEP
HGWVVDLVNKFGELGGFAAIQAKLHSEDIELGAVSALVQPLGVCAEYLNSSVVQPMLDPV
ILTAIQDVRSVEEKDLKDKRLVSIPELLSAIKLLCMRFQPDLVTVVDDLRLDILLRMLKS
PHFSAKMNSLKEVTKLIEDSTLSKSVKNAIDTDRLLDWLVENSVLSIALEGNIDQAQYCD
RIKGIIELLGSKLSLDELTKIWKIQSGQSSTVIENIHTIIAAAAVKFNSDQLNHLFVLIQ
KSWETESDRVRQKLLSLIGRIGREARFETTSGKVLDVLWELAHLPTLPSSLIQQALEEHL
TILSDAYAVKEAIKRSYIIKCIEDIKRPGEWSGLEKNKKDGFKSSQLNNPQFVWVVPALR
QLHEITRSFIKQTYQKQDKSIIQDLKKNFEIVKLVTGSLIACHRLAAAVAGPGGLTGSTL
VDGRYTYREYLEAHLKFLAFFLQEATLYLGWNRAKEIWECLVTGQDVCELDREMCFEWFT
KGQHDLESDVQQQLFKEKILKLESYEITMNGFNLFKTFFENVNLCDHRLKRQGAQLYVEK
LELIGMDFIWKIAMESPDEEIANEAIQLIINYSYINLNPRLKKDSVSLHKKFIADCYTRL
EAASSALGGPTLTHAVTRATKMLTATAMPTVATSVQSPYRSTKLVIIERLLLLAERYVIT
IEDFYSVPRTILPHGASFHGHLLTLNVTYESTKDTFTVEAHSNETIGSVRWKIAKQLCSP
VDNIQIFTNDSLLTVNKDQKLLHQLGFSDEQILTVKTSGSGTPSGSSADSSTSSSSSGSG
AFSSSYAMEQEKSLPGVVMALVCNVFDMLYQLANLEEPRITLRVRKLLLLIPTDPAIQEA
LDQLDSLGRKKTLLSETSSQSSKSPSLSSKQQHQPSASSILESLFRSFAPGMSTFRVLYN
LEVLSSKLMPTADDDMARSCAKSFCENFLKAGGLSLVVNVMQRDSIPSEVDYETRQGVYS
ICLQLARFLLVGQTMPTLLDEDLTKDGIEALSSRPFRNVSRQTSRQMSLCGTPEKSSYRQ
LSVSDRSSIRVEEIIPAARVAIQTMEVSDFTSTVACFMRLSWAAAAGRLDLVGSSQPIKE
SNSLFPAGIRNRLSSSGSNCSSGSEGDPAALHAGICVRQQSVSTKDSLIAGEALSLLVTC
LQLRSQQLASFYNLPCVADFIIDILLGSPSAEIRRAACDQLYTLSQTDTSAHPDVQKPNQ
FLLGVILTAQLPLWSPTSIMRGVNQRLLSQCMEYFDLRCQLLDDLTTSEMEQLRISPATM
LEDEITWLDNFEPNRTAECETSEADNILLAGHLRLIKTLLSLCGAEKEMLGSSLIKPLLD
DFLFRASRIILNSHSPAGSAAISQQDFHPKCSTVNSRLAAYEVLVMLADSSPANLQIITK
ELLSMHHQPDPALTKEFDYLPPVDSRSSSGFVGLRNGGATCYMNAVFQQLYMQPGLPESL
LSVDDDTDNPDDSVFYQVQSLFGHLMESKLQYYVPENFWKIFKMWNKELYVREQQDAYEF
FTSLIDQMDEYLKKMGRDQIFKNTFQGIYSDQKICKDCPHRYEREEAFMALNLGVTSCQS
LEISLDQFVRGEVLEGSNAYYCEKCKEKRITVKRTCIKSLPSVLVIHLMRFGFDWESGRS
IKYDEQIRFPWMLNMEPYTVSGMARQDSSSEVGENGRSMDQGGGGSPRKKVALTENYELV
GVIVHSGQAHAGHYYSFIKDRRGCGKGKWYKFNDTVIEEFDLNDETLEYECFGGEYRPKV
YDQTNPYTDVRRRYWNAYMLFYQRVSDQNSPVLPKKSRVSVVRQEAEDLSLSAPSSPEIS
PQSSPRPHRPNNDRLSILTKLVKKGEKKGLFVEKMPARIYQMVRDENLKFMKNRDVYSSD
YFSFVLSLASLNATKLKHPYYPCMAKVSLQLAIQFLFQTYLRTKKKLRVDTEEWIATIEA
LLSKSFDACQWLVEYFISSEGRELIKIFLLECSVREVRVAVATVLEKTLDSALFYQDKLK
SLHQLLEVLLALLDKDVPENCKNCAQYFFLFNTFVQKQGIRAGDLLLRHSALRHMTSFLL
GANRQNNQIRRWSSAQAREFGNLHNVVALLVLHSDVSSQRNVAPGVFKQRPPISIAPSSP
LLPLHEEVEALLFLSEGKPYLLEVMFALRELTGSLLALIEMVVYCCFCNEHFSFTMLHFI
KNQLETAPPHELKNTFQLLHEILVIEDPIQVERVKFVFETENGLLALMHHSNHVDSSRCY
QCVKFLVTLAQKCPAAKEYFKENSHHWSWAVQWLQKKMSEHYWTPQSNVSNETSTGKTFQ
RTISAQDTLAYATALLNEKEQSGSSNGSESSPANENGERHLQQGSESPMMIGELRSDLDD
VDP
NT seq 7572 nt NT seq  +upstreamnt  +downstreamnt
atgatgggggctcatggaggtggtgagagcaagaagaatgatgaaaacggaaactgctcg
ggggaagggatcgagttccccaccacaaatctgtacgagctggaaagccgcgttttgacc
gatcactggtccatcccctacaagcgggaagaatcactgggcaaatgcctgttggcgtcc
acctacctggccagactcggtctttccgagtctgatgagaattgtaaaagatttatggat
aggtgtatgcctgaagcatttaaaaagctcctgacatcaagtgctgttcacaagtggggt
actgaaattcatgaaggaatctacaacatgttgatgctattaatagaactggttgcagag
agaattaaacaagatccgattcccacaggtctcctgggtgtgcttacgatggctttcaat
cccgataatgagtaccattttaaaaacagaatgaaaacatctcaaaggaattggacagaa
gtgtttggggagggaaatatgtttgctgtttcacctgtgtctactttccaaaaggagcct
cacggatgggttgtggatttggtaaataagtttggagaattaggcggatttgcagcaatc
caagccaagcttcattcggaagatatagaacttggggcggtctcagcattggtgcagccc
ttgggggtgtgtgcggagtacctcaattcctcggtggttcagccgatgctagacccagtc
atccttactgcgatccaggatgtacggagcgtggaggaaaaggacctcaaagataagaga
ttggttagcatccccgagctcttgtctgccatcaagttactctgcatgcgcttccagccg
gatttggtgaccgtggtggatgaccttcgattagacatcctactgcgcatgctgaagtcg
ccacattttagcgctaaaatgaattccctcaaagaagtaaccaaactaatagaagatagc
actttatccaaatctgtgaagaatgctatagatacagacagattgttagattggctggtt
gaaaactcagttctgtccattgcactggaaggcaacatagaccaagcacaatactgtgat
cgtataaaggggattattgaactcttgggcagtaaattgtctttagatgaacttactaaa
atttggaagatacagtcgggacaatcatctactgtgatcgagaacatccatactattatt
gctgcagcagctgtcaaatttaattcagatcagcttaatcatttgtttgttctcattcag
aagagctgggagacggaaagcgatagagtaagacagaagctgttgagcctgattggacga
ataggccgggaagctcgctttgagaccacgtctggaaaggtgttagatgtactctgggaa
ctggcccatcttccgaccctgcccagtagccttatccagcaagccctggaggagcacctg
acgatcctgagtgacgcatacgcggtgaaggaagcaatcaagagaagctacatcattaag
tgcatagaagatattaaaaggcccggagagtggtcaggtttggaaaaaaacaagaaggac
ggattcaagtcgtctcagcttaacaatccccagtttgtgtgggtggtgccagccttgcgt
cagctccacgagatcacccgctcgttcataaaacagacctatcaaaagcaagacaagagc
atcattcaagacttgaagaaaaattttgaaatcgtgaagttggtgaccggaagtttgata
gcttgtcatcgactcgcagccgctgtggctggacccggaggcctgactggttccacgctg
gtggatggccgatacacttaccgggagtatttagaggcccatctaaaatttctagcgttt
ttcttgcaagaagccactctgtatctgggttggaatcgtgccaaggaaatctgggagtgt
cttgtgactggccaggatgtttgtgaattggatcgagagatgtgttttgaatggtttaca
aaaggccaacatgatctcgagagtgacgttcagcagcagcttttcaaggagaaaattctt
aaattggagtcatatgaaatcaccatgaatgggtttaacttgtttaagactttttttgaa
aatgtgaatctttgtgatcatcgattgaaacgacaaggagctcagttgtatgtagaaaag
ctggaattgataggaatggatttcatttggaaaatagccatggaatcacctgatgaagaa
attgctaatgaagctattcagttaatcataaactatagttacattaatctaaatcccaga
ttgaagaaggattccgtatcgttacataagaaatttattgctgattgttacacgagatta
gaagcagccagctcagcacttggtggccccactctgacgcatgcagtgaccagagcaaca
aaaatgcttacggcaactgctatgccaaccgtagcaacatccgttcagtctccatataga
tccaccaaacttgtaataatcgagagactgctgcttttggcagaacgctatgtgatcact
atagaggatttttactctgttccacgaactattctacctcatggtgcctcatttcatgga
catcttttaactctcaacgtcacgtatgagtctaccaaagataccttcactgtagaggct
cacagtaatgaaaccatagggagcgtgcgatggaagatagccaagcagttgtgctcacct
gtggacaacatacagatatttacgaacgatagcctgctgaccgtgaataaagatcaaaag
ctcctccaccagctgggcttttctgatgaacagatcctcacggtgaagacttcgggcagc
gggaccccatccggcagctccgcggactcctcgaccagctccagcagcagcggcagcggg
gcctttagctcatcgtacgccatggagcaggagaagtccctccctggtgttgtgatggca
cttgtatgtaatgtgtttgacatgctttaccagctggccaatctggaggagccaaggata
actctacgcgtacgaaagcttctcctgttgatacccactgacccagccattcaggaagcc
ctggatcaacttgattctttaggaagaaagaaaacattactgtccgaaacgagttctcag
tcctcaaagtctccatccctgtcctcaaagcagcagcatcagccaagcgccagctcgatt
ttggaaagtctgtttcgctcttttgctccgggaatgtccaccttccgagtgctctacaac
ttagaagttctgagctccaaactcatgccaacagctgatgatgacatggcaaggagttgt
gcgaaatccttctgtgagaacttcctcaaagcaggagggttgagtttggttgtaaatgtc
atgcagagggattccatcccttcagaagtagactatgaaacaaggcagggagtttactcc
atctgcctacagcttgcaagattcttacttgttgggcaaacaatgcccacgttgttagat
gaagacctcaccaaagatggcatagaagcactttcttctcgcccattccgaaacgtcagc
cggcagacaagcaggcagatgtccttgtgtggtaccccagagaagtcctcctaccgacag
ttgtccgtgtccgacaggtcttctatcagggtcgaggagatcatccctgctgcgcgagtt
gcgatacaaacaatggaagtaagtgacttcacgtctactgtggcttgtttcatgaggttg
tcgtgggctgcggctgcaggacgactggacctcgttgggagtagccagccaattaaagaa
agcaattctctgtttcctgctggaattcgaaacagactcagcagctcaggaagcaattgc
agctctgggagcgaaggggacccagcagccctgcacgcaggcatctgtgtgcgccagcag
tctgtgtccaccaaagactccctgatcgccggggaggctctctctcttcttgtcacgtgc
ctgcagcttcggagccagcaactggcatctttctataacttgccctgtgttgccgatttt
atcattgatattctgcttggatcaccaagtgctgagattcgccgtgctgcctgtgatcaa
ctatacactcttagtcagacagatacttcagctcatccagatgtccagaagccaaaccag
tttctcctaggtgtgattctcacagcccagctacctctctggtccccaactagtataatg
agaggagtcaatcagagactactatctcagtgtatggagtattttgatctaaggtgccaa
ttattagatgatctgacaacctcagaaatggagcagttaagaatcagcccggctaccatg
ctcgaagatgagatcacttggctggataactttgagcctaatcgcacggctgaatgtgag
accagtgaagcagacaacatcttattggcaggacacctacggctcattaagacccttctt
tcactgtgcggggcagagaaggaaatgcttggttcatcactcattaaaccattgttagat
gacttccttttccgagcttctagaattattttaaatagtcattctccagctggcagtgcc
gccatcagtcaacaggactttcatccaaagtgtagtacagtgaatagccgactggcagcc
tatgaagtccttgtgatgctggctgatagttccccggcaaatcttcaaattatcacaaaa
gaactgctttccatgcatcatcagcctgaccctgctctcaccaaggagtttgattatctt
ccccctgtggatagcaggtccagctcagggtttgtggggctgaggaatggcggcgctacg
tgttacatgaatgcagtcttccagcaactgtatatgcagcctggtctgcctgagtcgtta
ctttcagtagatgatgacacagacaatccagacgacagcgtattctaccaggtgcagtct
ctctttgggcatttgatggaaagcaagctgcagtattatgtacctgagaacttctggaag
attttcaagatgtggaacaaagaactttatgtgagagagcagcaggatgcatatgaattc
ttcactagtcttattgatcagatggacgaatatctcaagaaaatggggagagaccagatt
tttaagaatactttccagggcatctattctgaccagaagatctgtaaagactgtcctcac
agatatgagcgtgaggaagctttcatggccctcaatcttggagttacttcttgtcagagc
ttggaaatttctttggaccagtttgttagaggagaagttctagaaggaagtaatgcatat
tactgcgaaaagtgtaaagaaaagagaataactgtgaaaaggacctgcattaagtcttta
cctagcgtcttggtaattcacctaatgagatttggatttgactgggagagtggacgctcc
attaaatatgacgaacagataaggtttccctggatgctaaacatggagccctacacagtt
tcaggaatggctcgccaggattcgtcttctgaagttggtgaaaacgggcgaagtatggac
cagggaggtggaggatccccacgaaaaaaagttgccctcactgaaaactatgaacttgtc
ggtgtcattgtccacagtgggcaggcacatgcgggtcactactattccttcattaaggac
cgacgggggtgtggaaaaggaaaatggtacaagtttaatgacacagtcatagaagaattt
gacctaaatgatgagaccctggagtacgaatgctttggaggagaatatagaccaaaagtt
tatgatcaaacaaacccgtatacagatgttcgccgaagatactggaatgcctatatgctc
ttctaccaaagggtctctgatcaaaactccccagtattaccaaagaagagtcgagtcagt
gtggtacggcaggaagctgaggatctctctctgtcagcaccgtcctcaccggaaatttca
cctcagtcctcccctcggccccataggcctaacaatgaccggctctctattctaaccaag
ctggttaaaaaaggtgagaagaaagggctatttgtggagaaaatgcctgctcgaatatac
cagatggtgagagatgaaaacctcaagtttatgaagaatagagatgtatacagtagtgat
tatttcagttttgttttgtctttagcgtcactgaatgctactaaattaaagcatccatat
tatccttgcatggcaaaggtgagcttacagcttgcaattcagttcctttttcaaacttat
ctacggacaaagaaaaaactcagggttgatactgaagaatggattgccactattgaagca
ttactttccaaaagttttgatgcttgtcagtggctcgttgaatattttattagttctgaa
ggacgagaattaataaagattttcttgctggagtgcagcgtgcgagaagtgcgagttgcc
gtggccaccgttctggagaaaaccctagacagtgccttgttttatcaggataagttaaaa
agccttcatcagttactggaggtcctacttgctctgttggataaggatgtcccagaaaac
tgtaaaaactgtgctcagtactttttcctattcaacacttttgtacaaaagcaaggtatt
cgggctggggatcttcttctgaggcactcagctctgcgacacatgaccagctttctcctc
ggggccaaccggcaaaacaatcagatacgtcggtggagttcagcacaagcacgagaattt
gggaatcttcacaatgtagtggcgttacttgttttgcattcagatgtctcttcccaaagg
aacgttgctcctggtgtatttaaacaacggccacctattagcatcgccccctccagccct
ctgctgcccctccatgaggaagtagaagccttgttgttcttgtctgaagggaagccttac
ctgttagaggtgatgtttgctttgcgagagctgacgggctcgctcctggcgctcatcgag
atggtcgtgtactgctgcttctgtaacgagcacttctccttcaccatgctgcacttcatt
aagaaccaactagaaacggctccaccccatgagttgaagaatacgttccagctcctccat
gagatactggtcattgaagatcccatacaggtggagcgagtcaaatttgtgtttgagaca
gaaaatggattattagctctgatgcaccacagtaatcacgtggacagcagtcgctgctac
cagtgtgtcaaattcctcgtgactcttgctcaaaagtgtcctgctgctaaggaatacttc
aaggagaattcccaccactggagttgggctgtacaatggctacagaagaagatgtcagaa
cattactggactccacagagtaacgtctctaacgaaacatcaactggaaaaaccttccag
cggacgatttcagctcaggacaccctggcgtatgccacagctctgctgaatgagaaagag
cagtccgggagcagtaacggctcggagagcagtcccgcgaacgagaacggggagaggcat
ttacaacagggttcagagtcacccatgatgattggcgagttgagaagcgacctggacgat
gtcgacccctaa

DBGET integrated database retrieval system