KEGG   Felis catus (domestic cat): 101095326Help
Entry
101095326         CDS       T02385                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  
myosin regulatory light chain 7
Organism
fca  Felis catus (domestic cat)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101095326 (MYL7)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101095326 (MYL7)
   04530 Tight junction
    101095326 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    101095326 (MYL7)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101095326 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
A2
AA seq 182 aa AA seqDB search
MLQEHHMQASRKAGTRGKAAAAKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIIC
KSDLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILNAFRM
FDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGDVDYKSLCYIITHGDEK
EE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgctccaagagcatcacatgcaggccagcaggaaggcggggacccggggcaaggccgca
gctgccaagcaggcccagcgaggctcttctaacgtcttttccatgttcgagcaagcccag
atccaggaattcaaggaggccttcagctgcattgaccagaaccgtgatggcatcatctgc
aagtcagaccttcgggagacctactcccagctcgggaaggtgagcgtcccggaagaggaa
ctggatgccatgctgcaggaagggaagggtcccatcaacttcacggtcttcctcacgctc
ttcggggagaagctcaacgggacagaccccgaggaagccatcctgaacgccttccgcatg
tttgaccccagtggcaagggcgtggtgaacaaggatgagttcaaacagcttctcctgacc
caggcagacaagttctctccggctgaggtggagcagatgttcgccctgacgcccatggac
ctggcgggggacgtcgactacaagtctctgtgctacatcatcacccatggggatgagaaa
gaggagtga

DBGET integrated database retrieval system