KEGG   Felis catus (domestic cat): 101095326Help
Entry
101095326         CDS       T02385                                 

Gene name
MYL7
Definition
(RefSeq) myosin, light chain 7, regulatory
  KO
K12754  
myosin regulatory light chain 7
Organism
fca  Felis catus (domestic cat)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101095326 (MYL7)
  Cellular commiunity
   04510 Focal adhesion
    101095326 (MYL7)
   04530 Tight junction
    101095326 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    101095326 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
A2
AA seq 182 aa AA seqDB search
MLQEHHMQASRKAGTRGKAAAAKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIIC
KSDLRETYSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILNAFRM
FDPSGKGVVNKDEFKQLLLTQADKFSPAEVEQMFALTPMDLAGDVDYKSLCYIITHGDEK
EE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgctccaagagcatcacatgcaggccagcaggaaggcggggacccggggcaaggccgca
gctgccaagcaggcccagcgaggctcttctaacgtcttttccatgttcgagcaagcccag
atccaggaattcaaggaggccttcagctgcattgaccagaaccgtgatggcatcatctgc
aagtcagaccttcgggagacctactcccagctcgggaaggtgagcgtcccggaagaggaa
ctggatgccatgctgcaggaagggaagggtcccatcaacttcacggtcttcctcacgctc
ttcggggagaagctcaacgggacagaccccgaggaagccatcctgaacgccttccgcatg
tttgaccccagtggcaagggcgtggtgaacaaggatgagttcaaacagcttctcctgacc
caggcagacaagttctctccggctgaggtggagcagatgttcgccctgacgcccatggac
ctggcgggggacgtcgactacaagtctctgtgctacatcatcacccatggggatgagaaa
gaggagtga

DBGET integrated database retrieval system