KEGG   Felis catus (domestic cat): 101095398Help
Entry
101095398         CDS       T02385                                 

Gene name
CCNH
Definition
(RefSeq) cyclin-H isoform X2
  KO
K06634  cyclin H
Organism
fca  Felis catus (domestic cat)
Pathway
fca03022  Basal transcription factors
fca03420  Nucleotide excision repair
fca04110  Cell cycle
Module
fca_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    101095398 (CCNH)
  Replication and repair
   03420 Nucleotide excision repair
    101095398 (CCNH)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101095398 (CCNH)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     101095398 (CCNH)
DNA repair and recombination proteins [BR:fca03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     101095398 (CCNH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C
Motif
Other DBs
NCBI-GeneID: 101095398
NCBI-ProteinID: XP_003981185
Ensembl: ENSFCAG00000004828
UniProt: M3W2X6
Position
A1
AA seq 323 aa AA seqDB search
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPVFLEPHEEMMLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPM
MENPEMLRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNIITKKRKGYEDD
DYVSKKPKHEEEEWTDDDLVDSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacaacagtagccagaagcggcactggactttcgccagtgaggagcagctagca
cgactgcgggcggacgccaaccgtaaattcaaatgcaaagcggtcgccaacgggaaggtt
cttccaaacgatccagtctttcttgagcctcacgaagaaatgatgctctgcaaatactat
gagaagagattattagaattctgttcagtgtttaagccagcaatgccacggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataattcagtaatggaatatcac
ccccggataataatgctcacttgtgcatttttggcctgcaaagtagatgaattcaatgta
tctagtccacagtttgttggaaatctgcgggagagtcctcttggacaggagaaggcactc
gaacagattttggaatacgaactacttcttatacaacaactgaatttccaccttattgtc
cacaatccttatagaccatttgagggctttctaattgatttaaagactcgctaccccatg
atggagaatccagagatgttgaggaaaacagccgatgactttcttaatagaattgcatta
acagatgcttaccttttatacacaccttcccaaattgccctgactgccattttatctagt
gcatctcgagcaggaattactatggaaagttatttatcagaaagtctgatgttgaaagag
aacagaacttgcttgtcacagttactagatataatgaaaagtatgagaaacttggtaaaa
aaatatgaaccacccagatctgaagaagttgctgttctgaaacagaagttagagagatgt
cactctgctgagcttgcccttaacataattacgaagaagaggaaaggctatgaagatgat
gattatgtctcaaagaaacccaaacatgaggaggaagaatggactgacgatgacctggtt
gattctctctaa

DBGET integrated database retrieval system