KEGG   Felis catus (domestic cat): 101095411Help
Entry
101095411         CDS       T02385                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
fca  Felis catus (domestic cat)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101095411 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101095411 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    101095411 (PFN4)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101095411 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A3
AA seq 129 aa AA seqDB search
MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR
REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL
GEYLRRKGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt
gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta
atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga
agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct
ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg
gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg
ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system