KEGG   Felis catus (domestic cat): 101095578Help
Entry
101095578         CDS       T02385                                 

Gene name
PPT2
Definition
palmitoyl-protein thioesterase 2
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
fca  Felis catus (domestic cat)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fca01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:fca00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:fca04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B2
AA seq 309 aa AA seqDB search
MKSCGSMLGLRGLRLPPAGILLLLPFLPLLLLPAAPAPHRAPYKPVIVVHGLFDSSYSFR
HLLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFGEAVAPIMAKAPQGVHLICYSQG
GLVCRALLSVMDEHNVDSFISLSSPQMGQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEF
SICNYWHDPHHDDLYLNASSFLALINGERDHPNATAWRKNFLRVGRLVLIGGPDDGVITP
WQSSFFGFYDANETVLEMEEQPVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLY
ETCIEPWLS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcgggagcatgctggggctcagggggctgcggctgcccccggcggggatc
ctgctcctgttgccgttcctgccgctgctgctgctgcccgcagcccccgcgccccatcgc
gctccctacaagccggtcatcgtggtgcacgggctctttgacagctcgtacagcttccgc
cacctgctggaatatatcaacgagacacaccccgggactgtggtgacagtgctcgatctc
ttcgatgggagagagagcttgcgacccttgtgggaacaggtgcaagggttcggagaggct
gtggcccccatcatggcaaaggcccctcaaggggtgcatctcatctgctactcgcagggg
ggcctggtgtgccgggcactgctctctgtcatggatgagcacaatgtggattctttcatc
tctctctcctctccacaaatgggacagtatggagatacagactatttgaagtggctcttc
cctacctccatgaggtctaacctctatcggatctgctatagcccctggggccaggaattc
tccatctgcaactactggcacgacccccaccatgatgacttgtacctcaacgccagcagc
tttctggccctgatcaatggggaaagagatcatcccaatgccactgcatggaggaagaac
tttcttcgtgtgggccgcctggtgctgattgggggccctgatgatggtgttattaccccc
tggcagtccagcttctttggtttctatgatgcaaatgagacggtcttggagatggaggag
caaccggtttatctgcgggattcttttgggttgaagactctcttggctcggggagccata
gtgaggtgtccgatggctgggatctcccatacggcctggcactccaaccgtaccctttat
gagacctgcattgaaccttggctctcctga

DBGET integrated database retrieval system