KEGG   Felis catus (domestic cat): 101095663Help
Entry
101095663         CDS       T02385                                 

Gene name
USP8
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 8
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04137  Mitophagy - animal
fca04144  Endocytosis
fca04934  Cushing's syndrome
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101095663 (USP8)
   04137 Mitophagy - animal
    101095663 (USP8)
 Human Diseases
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    101095663 (USP8)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101095663 (USP8)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101095663 (USP8)
Membrane trafficking [BR:fca04131]
 Endosome - Lysosome transport
  Others
   Others
    101095663 (USP8)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101095663 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH USP8_dimer UCH_1 Rhodanese Metallothio_Pro
Motif
Other DBs
NCBI-GeneID: 101095663
NCBI-ProteinID: XP_023111139
Position
B3
AA seq 1116 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGLANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEQLQKQKRQEAGREDGGTSNKSSLENVMDSRDKTQKINGEKSDKNETTEKG
AITAKELYTMMMDENISLIIMDARRMQDYQDSHISNSLSVPEEAISPGVTASWIEAKLPD
DSKDTWKKRGNVEYVVLLDWFSSTKDLQLGTTLRSLKDALFKWESKTVLRNEPLVLEGGY
DNWLLCYPQYTTNAKVTPPPRGKNEEVSISLDFTYPSLEESIPSKPTAQMPLPSVEINEN
TEFLNDQDERMAPLNISTPIESIAASKSDVLPIIQPVPVVKNVPQVDRTKKPAVKLPEDH
RIKSENKDHEQQSSQDGKLVPDRSTKPVFPPPTAMLTDEEKARIHAETALLMEKNKQEKE
LREKQQEEQKEKLRREEQEQKVRKKQETEESEITEKQQKAKEEMERRESEQAKKEDKETS
AKRGKEITGIKRQSKSEHETTDAKKSAEDRGKRCPTPELQKKSVGDGPHASVAGDSNSGK
PVKIKGQPESGILKTGTFRENTEDTERNKAREPLTRARSEEMGRIVPGLPSGWAKFLDPI
TGTFRYYHSPTNTVHMYPPEMAPSSAPPATPPTHKAKPQIPAERDREPSKLKRSYSSPDI
TQAIQEEEKRKPTVTPTVNRENKPTCYPKAEITRLSASQIRNLNPVFGGSGPALTGLRNL
GNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQY
RYISPKDFKITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRHKEENNDHLD
DFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKC
TLQDCLRLFSKEEKLTDNNRFYCSHCRTRRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQ
KLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFK
FDDHEVSDISVSSVKSSAAYILFYTSLGPRATDVAT
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcccaaagaactctacctcagttcttcactaaaagacctc
aataagaagacagaagttaaaccagagaaaataagcacgaagaattatgtacagagtgcc
ctgaagatcttcaagacagcagaagaaagcagattagatcgtgatgaggaaagggcctat
gtactatatatgaaatatgtgactgtttataatcttatcaaaaaaaggcctgatttcaag
caacagcaggactactttcattcaatacttggacttgcaaacatcaaaaaagctattgaa
gaagccgaaagactctctgaaagccttaaactcagatatgaagaagctgaggttcgaaaa
aaacttgaagaaaaggacagacaggaggagcagctgcagaaacagaaaaggcaagaagca
ggaagagaggatggtggtacatcaaataaaagttccttggaaaatgtaatggattccaga
gacaaaacccaaaagataaatggtgaaaagagtgacaaaaatgagaccacagagaaaggg
gcaatcacagcgaaggagctatacacaatgatgatggatgaaaacatcagcttgattata
atggatgctcgaagaatgcaggattatcaagattcccatatttcaaattctctcagtgtt
cctgaagaagccatcagtccaggagtcactgctagttggattgaagcaaaactcccagat
gattctaaagacacatggaagaagagggggaatgtggaatatgtggtacttcttgactgg
tttagttcaacaaaagatttacaacttggaacaactctacggagtctgaaagatgcactt
ttcaagtgggaaagcaaaactgtcctgcgcaatgagcctttggttttagaaggaggctat
gacaactggctactttgttatccccagtatacaacaaatgctaaagtcactccaccccca
cgaggcaagaatgaagaggtgtctatctcattggattttacttatccttcactggaagaa
tcaattccttctaaacctactgcccagatgccacttccttctgtagaaataaatgaaaat
acagaatttttaaatgatcaagatgagagaatggcaccactgaacatatcaactccaatt
gagtcaattgctgcttctaaatctgatgttttacccataattcagccagtgcctgttgta
aagaatgttccacaggttgatcgtactaaaaaaccagcagtcaaattgcctgaagatcat
agaataaaatctgaaaataaagatcacgagcaacagtcttctcaggatggaaaacttgtt
cctgatcgctccacaaagccagtatttccccctccaactgccatgttaacagatgaagaa
aaagctcgtattcatgcagaaactgctcttctaatggagaaaaacaaacaagaaaaagaa
cttcgagaaaagcagcaagaagaacagaaagagaaactgaggagagaagaacaagaacaa
aaagtcagaaagaaacaagaaactgaagaaagtgaaatcaccgagaaacaacaaaaagca
aaagaagaaatggaaaggagagaaagtgaacaggccaagaaagaagataaggaaacctca
gcaaagaggggcaaagaaataacaggaataaaaagacaaagtaaaagtgaacatgaaact
actgatgctaagaaatctgcagaagataggggtaaaaggtgtcccaccccagaactgcag
aaaaagtcagtgggagatggaccccatgcctctgtggcaggagattcaaattcaggcaag
cctgttaagattaaaggacaaccagaaagtggaattctaaagactggaacttttagagag
aatacagaagatactgaaagaaacaaagctcgagaacctttgacaagagcacgaagtgaa
gaaatggggaggatcgtaccaggactgccttcaggctgggccaagtttcttgacccaatc
actggaacttttcgttattatcattcacccaccaacactgttcatatgtatccaccggaa
atggctccttcatctgcacctcctgccacccctccaactcataaagccaagccacagatc
cctgctgagcgggatagggaaccgtccaaactgaagcgttcctactcctccccagatata
acccaggccattcaagaggaagagaagaggaagccaacagtaactccaacagttaatcgg
gaaaataagccaacgtgctaccctaaagctgagatcacaaggctttctgcttctcagatt
cggaacctcaatcctgtttttggaggatctggaccagctctcactggacttcgtaattta
ggaaatacttgctatatgaactcaatactgcagtgcctatgtaatgctccacatttggcc
gattatttcaaccgaaactgttaccaggacgatattaacaggtcaaatttgttggggcat
aaaggtgaagtggctgaagagtttggcataattatgaaagccctgtggacaggacagtac
aggtatatcagtccaaaagactttaaaatcaccattgggaagatcaatgaccagtttgca
ggatatagccagcaagattcacaagaactgcttctgttcctaatggatggactccatgaa
gatctaaataaagctgataatcggaagagacataaagaagaaaataatgatcaccttgat
gactttaaagctgcagagcatgcttggcagaaacataagcagctcaatgaatctattatc
gttgcactttttcagggtcagttcaaatccacagtacagtgcctcacctgtcacaaaaag
tctaggacatttgaggccttcatgtatttgtctctaccattagcttctacaagtaaatgt
acattacaggactgccttagattattttccaaagaagaaaagctcacagacaacaacagg
ttttactgcagtcattgcagaactcgacgggactctctaaaaaagatagagatctggaag
ttgccacctgtgcttttagtgcatctgaaacgtttttcctacgatggcaggtggaagcag
aaactacagacctctgtggatttcccattagagaatcttgacttgtcacagtatgttatt
ggtccaaagaacaatttgaagaaatataatttgttttctgtttcaaatcactatggtggg
ctggatggaggccactacactgcctattgtaaaaatgcagcaagacagcggtggtttaaa
tttgatgatcatgaagtttctgatatctccgtttcttctgtgaagtcttcggcagcttat
atcctcttttatacttcattgggaccacgagcaactgatgtagccacataa

DBGET integrated database retrieval system