KEGG   Felis catus (domestic cat): 101095663Help
Entry
101095663         CDS       T02385                                 

Gene name
USP8
Definition
(RefSeq) ubiquitin specific peptidase 8
  KO
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101095663 (USP8)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101095663 (USP8)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101095663 (USP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B3
AA seq 1101 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKNYVQSALKIFKTAEESRLDRDEERAY
VLYMKYVTVYNLIKKRPDFKQQQDYFHSILGLANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEQLQKQKRQEAGREDGGTSNKSSLENVMDSRDKTQKINGEKSDKNETTEKG
VISLSGLFPTCLDDFVVKMILMVREVGWLFSAGVTASWIEAKLPDDSKDTWKKRGNVEYV
VLLDWFSSTKDLQLGTTLRSLKDALFKWESKTVLRNEPLVLEGGYDNWLLCYPQYTTNAK
VTPPPRGKNEEVSISLDFTYPSLEESIPSKPTAQMPLPSVEINENTEFLNDQDERMAPLN
ISTPIESIAASKSDVLPIIQPVPVVKNVPQVDRTKKPAVKLPEDHRIKSENKDHEQQSSQ
DGKLVPDRSTKPVFPPPTAMLTDEEKARIHAETALLMEKNKQEKELREKQQEEQKEKLRR
EEQEQKVRKKQETEESEITEKQQKAKEEMERRESEQAKKEDKETSAKRGKEITGIKRQSK
SEHETTDAKKSAEDRGKRCPTPELQKKSVGDGPHASVAGDSNSGKPVKIKGQPESGILKT
GTFRENTEDTERNKAREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVH
MYPPEMAPSSAPPATPPTHKAKPQIPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVT
PTVNRENKPTCYPKAEITRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCN
APHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKI
NDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRHKEENNDHLDDFKAAEHAWQKHKQL
NESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKL
TDNNRFYCSHCRTRRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDL
SQYVIGPKNNLKKYNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVK
SSAAYILFYTSLGPRATDVAT
NT seq 3306 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcccaaagaactctacctcagttcttcactaaaagacctc
aataagaagacagaagttaaaccagagaaaataagcacgaagaattatgtacagagtgcc
ctgaagatcttcaagacagcagaagaaagcagattagatcgtgatgaggaaagggcctat
gtactatatatgaaatatgtgactgtttataatcttatcaaaaaaaggcctgatttcaag
caacagcaggactactttcattcaatacttggacttgcaaacatcaaaaaagctattgaa
gaagccgaaagactctctgaaagccttaaactcagatatgaagaagctgaggttcgaaaa
aaacttgaagaaaaggacagacaggaggagcagctgcagaaacagaaaaggcaagaagca
ggaagagaggatggtggtacatcaaataaaagttccttggaaaatgtaatggattccaga
gacaaaacccaaaagataaatggtgaaaagagtgacaaaaatgagaccacagagaaaggt
gttatttccctaagtggtttgttcccaacttgtttagacgattttgttgtcaaaatgatc
ttgatggttagagaagtagggtggttattttcagctggagtcactgctagttggattgaa
gcaaaactcccagatgattctaaagacacatggaagaagagggggaatgtggaatatgtg
gtacttcttgactggtttagttcaacaaaagatttacaacttggaacaactctacggagt
ctgaaagatgcacttttcaagtgggaaagcaaaactgtcctgcgcaatgagcctttggtt
ttagaaggaggctatgacaactggctactttgttatccccagtatacaacaaatgctaaa
gtcactccacccccacgaggcaagaatgaagaggtgtctatctcattggattttacttat
ccttcactggaagaatcaattccttctaaacctactgcccagatgccacttccttctgta
gaaataaatgaaaatacagaatttttaaatgatcaagatgagagaatggcaccactgaac
atatcaactccaattgagtcaattgctgcttctaaatctgatgttttacccataattcag
ccagtgcctgttgtaaagaatgttccacaggttgatcgtactaaaaaaccagcagtcaaa
ttgcctgaagatcatagaataaaatctgaaaataaagatcacgagcaacagtcttctcag
gatggaaaacttgttcctgatcgctccacaaagccagtatttccccctccaactgccatg
ttaacagatgaagaaaaagctcgtattcatgcagaaactgctcttctaatggagaaaaac
aaacaagaaaaagaacttcgagaaaagcagcaagaagaacagaaagagaaactgaggaga
gaagaacaagaacaaaaagtcagaaagaaacaagaaactgaagaaagtgaaatcaccgag
aaacaacaaaaagcaaaagaagaaatggaaaggagagaaagtgaacaggccaagaaagaa
gataaggaaacctcagcaaagaggggcaaagaaataacaggaataaaaagacaaagtaaa
agtgaacatgaaactactgatgctaagaaatctgcagaagataggggtaaaaggtgtccc
accccagaactgcagaaaaagtcagtgggagatggaccccatgcctctgtggcaggagat
tcaaattcaggcaagcctgttaagattaaaggacaaccagaaagtggaattctaaagact
ggaacttttagagagaatacagaagatactgaaagaaacaaagctcgagaacctttgaca
agagcacgaagtgaagaaatggggaggatcgtaccaggactgccttcaggctgggccaag
tttcttgacccaatcactggaacttttcgttattatcattcacccaccaacactgttcat
atgtatccaccggaaatggctccttcatctgcacctcctgccacccctccaactcataaa
gccaagccacagatccctgctgagcgggatagggaaccgtccaaactgaagcgttcctac
tcctccccagatataacccaggccattcaagaggaagagaagaggaagccaacagtaact
ccaacagttaatcgggaaaataagccaacgtgctaccctaaagctgagatcacaaggctt
tctgcttctcagattcggaacctcaatcctgtttttggaggatctggaccagctctcact
ggacttcgtaatttaggaaatacttgctatatgaactcaatactgcagtgcctatgtaat
gctccacatttggccgattatttcaaccgaaactgttaccaggacgatattaacaggtca
aatttgttggggcataaaggtgaagtggctgaagagtttggcataattatgaaagccctg
tggacaggacagtacaggtatatcagtccaaaagactttaaaatcaccattgggaagatc
aatgaccagtttgcaggatatagccagcaagattcacaagaactgcttctgttcctaatg
gatggactccatgaagatctaaataaagctgataatcggaagagacataaagaagaaaat
aatgatcaccttgatgactttaaagctgcagagcatgcttggcagaaacataagcagctc
aatgaatctattatcgttgcactttttcagggtcagttcaaatccacagtacagtgcctc
acctgtcacaaaaagtctaggacatttgaggccttcatgtatttgtctctaccattagct
tctacaagtaaatgtacattacaggactgccttagattattttccaaagaagaaaagctc
acagacaacaacaggttttactgcagtcattgcagaactcgacgggactctctaaaaaag
atagagatctggaagttgccacctgtgcttttagtgcatctgaaacgtttttcctacgat
ggcaggtggaagcagaaactacagacctctgtggatttcccattagagaatcttgacttg
tcacagtatgttattggtccaaagaacaatttgaagaaatataatttgttttctgtttca
aatcactatggtgggctggatggaggccactacactgcctattgtaaaaatgcagcaaga
cagcggtggtttaaatttgatgatcatgaagtttctgatatctccgtttcttctgtgaag
tcttcggcagcttatatcctcttttatacttcattgggaccacgagcaactgatgtagcc
acataa

DBGET integrated database retrieval system