KEGG   Felis catus (domestic cat): 101095885Help
Entry
101095885         CDS       T02385                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1 isoform X3
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04068  FoxO signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04152  AMPK signaling pathway
fca04211  Longevity regulating pathway
fca04213  Longevity regulating pathway - multiple species
fca04371  Apelin signaling pathway
fca04530  Tight junction
fca04710  Circadian rhythm
fca04714  Thermogenesis
fca04910  Insulin signaling pathway
fca04920  Adipocytokine signaling pathway
fca04921  Oxytocin signaling pathway
fca04922  Glucagon signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101095885 (PRKAA1)
   04068 FoxO signaling pathway
    101095885 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    101095885 (PRKAA1)
   04152 AMPK signaling pathway
    101095885 (PRKAA1)
   04150 mTOR signaling pathway
    101095885 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101095885 (PRKAA1)
  Cellular community - eukaryotes
   04530 Tight junction
    101095885 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101095885 (PRKAA1)
   04922 Glucagon signaling pathway
    101095885 (PRKAA1)
   04920 Adipocytokine signaling pathway
    101095885 (PRKAA1)
   04921 Oxytocin signaling pathway
    101095885 (PRKAA1)
  Aging
   04211 Longevity regulating pathway - mammal
    101095885 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    101095885 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    101095885 (PRKAA1)
   04714 Thermogenesis
    101095885 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101095885 (PRKAA1)
   05410 Hypertrophic cardiomyopathy (HCM)
    101095885 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101095885 (PRKAA1)
   04931 Insulin resistance
    101095885 (PRKAA1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101095885 (PRKAA1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   101095885 (PRKAA1)
Membrane trafficking [BR:fca04131]
 Autophagy
  Other autophagy associated proteins
   Others
    101095885 (PRKAA1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101095885 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    101095885 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like Kdo FTA2 APH Haspin_kinase YukC
Motif
Other DBs
NCBI-GeneID: 101095885
NCBI-ProteinID: XP_011284704
Ensembl: ENSFCAG00000023817
Position
A1
AA seq 535 aa AA seqDB search
MNPSIGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPS
DIFMVMEYVSGGELFDYICKNGRKSDVPGVVRTGSMKELDEKESRRLFQQILSGVDYCHR
HMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAG
PEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVD
PMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLY
NRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETP
RARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYL
RVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSC
QRNDSDADAQGKSSEASLTSSVTSLDSSVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctccattggcaaacatgaattgactgggcacaaagttgctgtgaagatactc
aatcgacagaagattcgaagccttgatgtggtaggaaaaatccgcagagaaattcagaac
ctcaagcttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatct
gatattttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaa
aatggaaggaaatctgatgtacctggagtagtaagaacaggctccatgaaggagctggat
gaaaaagaaagtcggcgtctgttccaacagatcctttctggtgtggattactgtcacagg
catatggtggtccatagagatttgaaacctgaaaatgtcctgcttgatgcacacatgaat
gcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaatttttaagaaca
agctgtggctcacccaactacgctgcaccagaagtaatttcaggaagattgtatgcaggt
ccagaggtagacatatggagcagtggggttattctctatgctttattatgtggaaccctt
ccgtttgatgatgatcatgtgccaactctttttaagaagatatgtgatgggatcttttat
acccctcagtatttaaatccatctgtgattagccttttgaaacatatgctacaggtggat
cccatgaagagggccacaatcaaagatatcagggagcatgaatggtttaaacaagatctt
ccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgatgatgaagcc
ttaaaagaagtgtgtgaaaaatttgaatgctcagaagaggaggttctcagctgcctttat
aatagaaatcaccaggacccgttggcagttgcctatcacctcataatagataacaggagg
ataatgaatgaggccaaagatttttacttggcaacaagcccacctgattcttttctcgat
gatcatcatttgactcggccccatcctgaaagagtaccattcttggttgctgaaacgcca
agggcacgccacaccctcgatgaattaaacccacagaaatcaaaacaccaaggtgtaagg
aaagcaaaatggcatttgggaattagaagtcaaagtcgaccaaatgatatcatggcagaa
gtttgtagagcaattaaacaactggattacgaatggaaggttgtaaacccatattatttg
cgtgttcgaaggaagaatcctgtaacaagtacatactccaaaatgagtctacagttatac
caagtggatagtagaacgtacttactggatttccgtagcattgatgatgaaattactgaa
gccaaatcagggactgctactccacagagatcaggatcagttagcaactatcgatcttgc
caaaggaatgattcagatgctgatgctcaaggaaaatcctcagaagcttcacttacctca
tctgtgacctcacttgactcttctgttgacttaactccaagacctggaagtcacacgata
gagttttttgaaatgtgtgcgaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system