KEGG   Felis catus (domestic cat): 101095885Help
Entry
101095885         CDS       T02385                                 

Gene name
PRKAA1
Definition
(RefSeq) protein kinase, AMP-activated, alpha 1 catalytic subunit
  KO
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
fca  Felis catus (domestic cat)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    101095885 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    101095885 (PRKAA1)
   04152 AMPK signaling pathway
    101095885 (PRKAA1)
   04150 mTOR signaling pathway
    101095885 (PRKAA1)
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    101095885 (PRKAA1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101095885 (PRKAA1)
   04922 Glucagon signaling pathway
    101095885 (PRKAA1)
   04920 Adipocytokine signaling pathway
    101095885 (PRKAA1)
   04921 Oxytocin signaling pathway
    101095885 (PRKAA1)
  Environmental adaptation
   04710 Circadian rhythm
    101095885 (PRKAA1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101095885 (PRKAA1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101095885 (PRKAA1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101095885 (PRKAA1)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   101095885 (PRKAA1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    101095885 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    101095885 (PRKAA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A1
AA seq 535 aa AA seqDB search
MNPSIGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPS
DIFMVMEYVSGGELFDYICKNGRKSDVPGVVRTGSMKELDEKESRRLFQQILSGVDYCHR
HMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAG
PEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVD
PMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLY
NRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTRPHPERVPFLVAETP
RARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYL
RVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSC
QRNDSDADAQGKSSEASLTSSVTSLDSSVDLTPRPGSHTIEFFEMCANLIKILAQ
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaatccctccattggcaaacatgaattgactgggcacaaagttgctgtgaagatactc
aatcgacagaagattcgaagccttgatgtggtaggaaaaatccgcagagaaattcagaac
ctcaagcttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatct
gatattttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaa
aatggaaggaaatctgatgtacctggagtagtaagaacaggctccatgaaggagctggat
gaaaaagaaagtcggcgtctgttccaacagatcctttctggtgtggattactgtcacagg
catatggtggtccatagagatttgaaacctgaaaatgtcctgcttgatgcacacatgaat
gcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaatttttaagaaca
agctgtggctcacccaactacgctgcaccagaagtaatttcaggaagattgtatgcaggt
ccagaggtagacatatggagcagtggggttattctctatgctttattatgtggaaccctt
ccgtttgatgatgatcatgtgccaactctttttaagaagatatgtgatgggatcttttat
acccctcagtatttaaatccatctgtgattagccttttgaaacatatgctacaggtggat
cccatgaagagggccacaatcaaagatatcagggagcatgaatggtttaaacaagatctt
ccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgatgatgaagcc
ttaaaagaagtgtgtgaaaaatttgaatgctcagaagaggaggttctcagctgcctttat
aatagaaatcaccaggacccgttggcagttgcctatcacctcataatagataacaggagg
ataatgaatgaggccaaagatttttacttggcaacaagcccacctgattcttttctcgat
gatcatcatttgactcggccccatcctgaaagagtaccattcttggttgctgaaacgcca
agggcacgccacaccctcgatgaattaaacccacagaaatcaaaacaccaaggtgtaagg
aaagcaaaatggcatttgggaattagaagtcaaagtcgaccaaatgatatcatggcagaa
gtttgtagagcaattaaacaactggattacgaatggaaggttgtaaacccatattatttg
cgtgttcgaaggaagaatcctgtaacaagtacatactccaaaatgagtctacagttatac
caagtggatagtagaacgtacttactggatttccgtagcattgatgatgaaattactgaa
gccaaatcagggactgctactccacagagatcaggatcagttagcaactatcgatcttgc
caaaggaatgattcagatgctgatgctcaaggaaaatcctcagaagcttcacttacctca
tctgtgacctcacttgactcttctgttgacttaactccaagacctggaagtcacacgata
gagttttttgaaatgtgtgcgaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system