KEGG   Felis catus (domestic cat): 101095885Help
Entry
101095885         CDS       T02385                                 

Gene name
PRKAA1
Definition
protein kinase, AMP-activated, alpha 1 catalytic subunit
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
fca  Felis catus (domestic cat)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
PI3K-Akt signaling pathway
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:fca04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:fca04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:fca04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:fca04140]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:fca04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:fca04920]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:fca04921]
Organismal Systems; Environmental adaptation; Circadian rhythm [PATH:fca04710]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:fca05410]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:fca04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
A1
AA seq 549 aa AA seqDB search
MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVV
GKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRR
LFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLN
PSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMIDDEALKEVCE
KFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDSFLDDHHLTR
PHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDIMAEVCRAIK
QLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTA
TPQRSGSVSNYRSCQRNDSDADAQGKSSEASLTSSVTSLDSSVDLTPRPGSHTIEFFEMC
ANLIKILAQ
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagccgagaagcagaaacacgacgggcgggtgaagatcggccactacatcctg
ggggacacgctgggggtcggcaccttcggcaaagtgaaggttggcaaacatgaattgact
gggcacaaagttgctgtgaagatactcaatcgacagaagattcgaagccttgatgtggta
ggaaaaatccgcagagaaattcagaacctcaagcttttcaggcatcctcatataattaaa
ctgtaccaggtcatcagtacaccatctgatattttcatggtgatggaatatgtctcagga
ggagagctatttgattatatctgtaaaaatggaaggctggatgaaaaagaaagtcggcgt
ctgttccaacagatcctttctggtgtggattactgtcacaggcatatggtggtccataga
gatttgaaacctgaaaatgtcctgcttgatgcacacatgaatgcaaagatagctgatttt
ggtctttcaaacatgatgtcagatggtgaatttttaagaacaagctgtggctcacccaac
tacgctgcaccagaagtaatttcaggaagattgtatgcaggtccagaggtagacatatgg
agcagtggggttattctctatgctttattatgtggaacccttccgtttgatgatgatcat
gtgccaactctttttaagaagatatgtgatgggatcttttatacccctcagtatttaaat
ccatctgtgattagccttttgaaacatatgctacaggtggatcccatgaagagggccaca
atcaaagatatcagggagcatgaatggtttaaacaagatcttccaaaatatctctttcct
gaggatccatcatatagttcaaccatgattgatgatgaagccttaaaagaagtgtgtgaa
aaatttgaatgctcagaagaggaggttctcagctgcctttataatagaaatcaccaggac
ccgttggcagttgcctatcacctcataatagataacaggaggataatgaatgaggccaaa
gatttttacttggcaacaagcccacctgattcttttctcgatgatcatcatttgactcgg
ccccatcctgaaagagtaccattcttggttgctgaaacgccaagggcacgccacaccctc
gatgaattaaacccacagaaatcaaaacaccaaggtgtaaggaaagcaaaatggcatttg
ggaattagaagtcaaagtcgaccaaatgatatcatggcagaagtttgtagagcaattaaa
caactggattacgaatggaaggttgtaaacccatattatttgcgtgttcgaaggaagaat
cctgtaacaagtacatactccaaaatgagtctacagttataccaagtggatagtagaacg
tacttactggatttccgtagcattgatgatgaaattactgaagccaaatcagggactgct
actccacagagatcaggatcagttagcaactatcgatcttgccaaaggaatgattcagat
gctgatgctcaaggaaaatcctcagaagcttcacttacctcatctgtgacctcacttgac
tcttctgttgacttaactccaagacctggaagtcacacgatagagttttttgaaatgtgt
gcgaatctaattaaaattcttgcacagtaa

DBGET integrated database retrieval system