KEGG   Felis catus (domestic cat): 101095887Help
Entry
101095887         CDS       T02385                                 

Gene name
CACNA2D2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101095887 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    101095887 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    101095887 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    101095887 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101095887 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101095887 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    101095887 (CACNA2D2)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   101095887 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 1081 aa AA seqDB search
MQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDR
KVQALKRLADAAENFQKAHRWQDNIKEEDILYYDAKADAELDDPESEDVERGSKASTLRL
DFVEDSNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIENRRQDPTLLWQV
FGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKL
MKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAVQGMVAKGTT
GYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRTVRVFTFSVG
QHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVY
EDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYV
FAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQIRTL
VKSLDERYVDEVMRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQVKYFEFLLPS
SFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGI
TQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAADDWTENPEPFNASFYRRSLDN
HGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGGRTLRPAVVGVKLDLEAWAEKFK
VLASNRTHQDQPQKCGPSSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFS
EVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFVPTIADFLNLAWWTSA
AAWSLFQQLLYGLIYHSWFQADPAEAEGNPEARESSCVMKQTQYYFGSVNASYNAIIDCG
NCSRLFHAQRLTNTNLLFXXXXXXXVVAEKPLCSQCEGGRLLQKETHSDGPEQCELVQRP
RYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVHAHASRR
V
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgcagcactgggcccggcgcctggagcaagagatcgatggcgtgatgcggatttttggg
ggcgtccagcagctccgtgagatctacaaggacaaccggaatctgtttgaggtgcaggag
aatgagcctcagaagttggtggagaaggtggcaggagacatcgagagcctgctggacagg
aaggtgcaggccctgaagagattggccgacgctgcagagaacttccagaaagcccaccgc
tggcaggacaacatcaaggaggaagacatcctgtactatgacgccaaggccgatgctgag
ctggacgaccctgagagtgaggatgtggagagggggtccaaggccagcaccctaaggctg
gacttcgttgaggactcaaacttcaagaacaaggtcaactactcgtacacggccgtgcag
atccccacggacatctacaaaggctccactgtcatccttaatgaactcaactggacagag
gccctggagaatgtgtttatcgagaaccgcaggcaggaccccacactgctgtggcaggtc
tttggcagtgccacaggagtcactcgctactatccagccaccccatggcgagcccctaag
aaaatcgacctgtacgatgtccgaaggagaccctggtatatccagggggcctcgtcgccc
aaggacatggtcatcatcgtggatgtgagcggcagcgtgagtggcctgaccctgaagctg
atgaagacgtccgtctgtgagatgctggacacgctctctgatgatgactatgtgaacgtg
gcctcgttcaatgaaaaggcacagcctgtgtcatgcttcacacacctggtgcaggccaat
gtgcgtaacaagaaggtgttcaaggaagctgtgcagggcatggtggccaagggcaccaca
ggctacaaggccggctttgagtatgccttcgaccagctgcagaactccaacatcactcgt
gccaactgcaataagatgatcatgatgttcacggatggtggtgaggaccgcgtgcaggat
gtctttgagaaatacaattggcccaaccggacggtgcgtgtgttcactttctccgtgggg
caacacaactacgacgtcacacccctgcagtggatggcctgcgccaacaaaggttactat
tttgagatcccttccattggagccatccgcattaacacacaggaatatctggatgtattg
ggcaggcccatggtactggcaggcaaggaggccaagcaggtgcagtggaccaacgtgtat
gaggatgcactggggctggggttagtggtgacagggaccctccctgttttcaacctgaca
caggatggccctggggaaaagaagaaccagctgatcctgggtgtgatgggcatcgatgtg
gctctgaatgacatcaagaggctcactccaaactacacgcttggagctaacggctatgtg
tttgccattgacctgaacggctacgtgttgctgcaccccaacctcaagccccagaccacc
aacttccgggagcctgtgactctggacttcctggatgctgagctggaggatgagaacaaa
gaggagatccgtcggagcatgatcgatggcaacaagggccacaagcaaatcagaacgctg
gtcaagtccctggacgagaggtacgtagacgaggtgatgcggaactacacctgggtacct
ataaggagcaccaactacagcctagggcttgtgctcccgccctacagcaccttctacctc
caagccaacctcagtgaccagatcctgcaggtcaagtattttgagttcctgctccccagc
agctttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggacctgaat
gcctcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtgact
ccagactccaagcagtgcaacaacttccttctgcacaacctgatcttggacacaggcatc
acacagcagctggtggagcgtgtgtggcgggaccaggatctcaacacgtacagccttctg
gccgtgttcgctgccactgatggtggcatcactcgcgtattccccaacaaagcagcagat
gactggacggagaatccagagcccttcaatgccagcttctaccgtcgtagcctggacaac
catggctatgtcttcaagcccccgcaccaggacgccctgttaaggccactggagctggag
aatgacacagtgggcatcctcgtcagcacagctgtggagctcagcctgggtggacgcaca
ctgaggccagcagtggtaggtgttaagctggacctagaggcctgggccgagaagttcaag
gtgctagccagcaaccgtacccaccaggaccagcctcagaagtgtggtcccagcagccac
tgtgagatggactgcgaggttaacaatgaggacctgctctgtgtcctcattgatgatggg
ggattcctggtgctgtcaaaccagaatcatcagtgggaccaggtgggcaggttcttcagt
gaggtggatgccaacctgatgctggcactctacaataactccttctacacccgcaaagag
tcctacgactatcaggcagcctgcgccccccaacccccaggcaacctgggtgctgcaccc
cggggggtctttgtgcccactattgcagacttccttaacttggcctggtggacctcggct
gcagcctggtccttgttccagcagcttctctatggcctcatttatcacagctggtttcag
gcagaccccgcggaggctgaggggaaccccgaagcgcgagagagcagctgcgtcatgaaa
cagacccagtactacttcgggtcggtgaacgcctcctacaacgccatcatcgactgcgga
aactgctccaggctgttccacgcgcaaagactgaccaacaccaaccttctcttcgnnnnn
nnnnnnnnnnnnnnngtggtggccgagaagcctctgtgcagccagtgtgagggtggccgg
cttctgcagaaagagacacactcggacggcccggagcagtgtgaactggtgcagagaccg
cgataccggagaggcccgcatatctgctttgactacaacgcgacggaagatacctcagac
tgcggccgcggagcttccttcccgccgtcgctgggcgtcctggtctccctgcagctgctg
ctcctcctgggcttgcctcctcggccgcagccccaagtccacgcccacgcctcgcgccgc
gtctga

DBGET integrated database retrieval system