KEGG   Felis catus (domestic cat): 101095887Help
Entry
101095887         CDS       T02385                                 

Gene name
CACNA2D2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:fca04010]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:fca04921]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:fca04260]
Organismal Systems; Circulatory system; Adrenergic signaling in cardiomyocytes [PATH:fca04261]
Human Diseases; Cardiovascular diseases; Hypertrophic cardiomyopathy (HCM) [PATH:fca05410]
Human Diseases; Cardiovascular diseases; Arrhythmogenic right ventricular cardiomyopathy (ARVC) [PATH:fca05412]
Human Diseases; Cardiovascular diseases; Dilated cardiomyopathy (DCM) [PATH:fca05414]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 1083 aa AA seqDB search
MQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIESLLDR
KVQALKRLADAAENFQKAHRWQDNIKEEDILYYDAKADAELDDPESEDVERGSKASTLRL
DFVEDSNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIENRRQDPTLLWQV
FGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKL
MKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAVQGMVAKGTT
GYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRTVRVFTFSVG
QHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQWTNVY
EDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGANGYV
FAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQIRTL
VKSLDERYVDEVMRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQVKYFEFLLPS
SFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLILDTGI
TQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAADDWTENPEPFNASFYRRSLDN
HGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGGRTLRPAVVGVKLDLEAWAEKFK
VLASNRTHQDQPQKCGPSSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFS
EVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFVPTIADFLNLAWWTSA
AAWSLFQQLLYGLIYHSWFQADPAEAEGNPEARESSCVMKQTQYYFGSVNASYNAIIDCG
NCSRLFHAQRLTNTNLLFXXXXXXXVVAEKPLCSQCEGGRLLQKETHCPADGPEQCELVQ
RPRYRRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVHAHAS
RRV
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgcagcactgggcccggcgcctggagcaagagatcgatggcgtgatgcggatttttggg
ggcgtccagcagctccgtgagatctacaaggacaaccggaatctgtttgaggtgcaggag
aatgagcctcagaagttggtggagaaggtggcaggagacatcgagagcctgctggacagg
aaggtgcaggccctgaagagattggccgacgctgcagagaacttccagaaagcccaccgc
tggcaggacaacatcaaggaggaagacatcctgtactatgacgccaaggccgatgctgag
ctggacgaccctgagagtgaggatgtggagagggggtccaaggccagcaccctaaggctg
gacttcgttgaggactcaaacttcaagaacaaggtcaactactcgtacacggccgtgcag
atccccacggacatctacaaaggctccactgtcatccttaatgaactcaactggacagag
gccctggagaatgtgtttatcgagaaccgcaggcaggaccccacactgctgtggcaggtc
tttggcagtgccacaggagtcactcgctactatccagccaccccatggcgagcccctaag
aaaatcgacctgtacgatgtccgaaggagaccctggtatatccagggggcctcgtcgccc
aaggacatggtcatcatcgtggatgtgagcggcagcgtgagtggcctgaccctgaagctg
atgaagacgtccgtctgtgagatgctggacacgctctctgatgatgactatgtgaacgtg
gcctcgttcaatgaaaaggcacagcctgtgtcatgcttcacacacctggtgcaggccaat
gtgcgtaacaagaaggtgttcaaggaagctgtgcagggcatggtggccaagggcaccaca
ggctacaaggccggctttgagtatgccttcgaccagctgcagaactccaacatcactcgt
gccaactgcaataagatgatcatgatgttcacggatggtggtgaggaccgcgtgcaggat
gtctttgagaaatacaattggcccaaccggacggtgcgtgtgttcactttctccgtgggg
caacacaactacgacgtcacacccctgcagtggatggcctgcgccaacaaaggttactat
tttgagatcccttccattggagccatccgcattaacacacaggaatatctggatgtattg
ggcaggcccatggtactggcaggcaaggaggccaagcaggtgcagtggaccaacgtgtat
gaggatgcactggggctggggttagtggtgacagggaccctccctgttttcaacctgaca
caggatggccctggggaaaagaagaaccagctgatcctgggtgtgatgggcatcgatgtg
gctctgaatgacatcaagaggctcactccaaactacacgcttggagctaacggctatgtg
tttgccattgacctgaacggctacgtgttgctgcaccccaacctcaagccccagaccacc
aacttccgggagcctgtgactctggacttcctggatgctgagctggaggatgagaacaaa
gaggagatccgtcggagcatgatcgatggcaacaagggccacaagcaaatcagaacgctg
gtcaagtccctggacgagaggtacgtagacgaggtgatgcggaactacacctgggtacct
ataaggagcaccaactacagcctagggcttgtgctcccgccctacagcaccttctacctc
caagccaacctcagtgaccagatcctgcaggtcaagtattttgagttcctgctccccagc
agctttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggacctgaat
gcctcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtgact
ccagactccaagcagtgcaacaacttccttctgcacaacctgatcttggacacaggcatc
acacagcagctggtggagcgtgtgtggcgggaccaggatctcaacacgtacagccttctg
gccgtgttcgctgccactgatggtggcatcactcgcgtattccccaacaaagcagcagat
gactggacggagaatccagagcccttcaatgccagcttctaccgtcgtagcctggacaac
catggctatgtcttcaagcccccgcaccaggacgccctgttaaggccactggagctggag
aatgacacagtgggcatcctcgtcagcacagctgtggagctcagcctgggtggacgcaca
ctgaggccagcagtggtaggtgttaagctggacctagaggcctgggccgagaagttcaag
gtgctagccagcaaccgtacccaccaggaccagcctcagaagtgtggtcccagcagccac
tgtgagatggactgcgaggttaacaatgaggacctgctctgtgtcctcattgatgatggg
ggattcctggtgctgtcaaaccagaatcatcagtgggaccaggtgggcaggttcttcagt
gaggtggatgccaacctgatgctggcactctacaataactccttctacacccgcaaagag
tcctacgactatcaggcagcctgcgccccccaacccccaggcaacctgggtgctgcaccc
cggggggtctttgtgcccactattgcagacttccttaacttggcctggtggacctcggct
gcagcctggtccttgttccagcagcttctctatggcctcatttatcacagctggtttcag
gcagaccccgcggaggctgaggggaaccccgaagcgcgagagagcagctgcgtcatgaaa
cagacccagtactacttcgggtcggtgaacgcctcctacaacgccatcatcgactgcgga
aactgctccaggctgttccacgcgcaaagactgaccaacaccaaccttctcttcgnnnnn
nnnnnnnnnnnnnnngtggtggccgagaagcctctgtgcagccagtgtgagggtggccgg
cttctgcagaaagagacacactgcccagcggacggcccggagcagtgtgaactggtgcag
agaccgcgataccggagaggcccgcatatctgctttgactacaacgcgacggaagatacc
tcagactgcggccgcggagcttccttcccgccgtcgctgggcgtcctggtctccctgcag
ctgctgctcctcctgggcttgcctcctcggccgcagccccaagtccacgcccacgcctcg
cgccgcgtctga

DBGET integrated database retrieval system