KEGG   Felis catus (domestic cat): 101095887Help
Entry
101095887         CDS       T02385                                 

Gene name
CACNA2D2
Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-2 isoform X1
  KO
K04859  voltage-dependent calcium channel alpha-2/delta-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04921  Oxytocin signaling pathway
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101095887 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    101095887 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    101095887 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    101095887 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101095887 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101095887 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    101095887 (CACNA2D2)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   101095887 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VGCC_alpha2 VWA_N VWA VWA_3 VWA_2 dCache_1 dCache_2 VWA_CoxE
Motif
Other DBs
NCBI-GeneID: 101095887
NCBI-ProteinID: XP_023104771
Ensembl: ENSFCAG00000007016
Position
A2
AA seq 1177 aa AA seqDB search
MAVPARTCGASRPGPARTALPWPGRGPRPGPGARRPPSGPPRPLLLLLPPLLLLPLFAAP
GASAYSFPQQHTMQHWARRLEQEIDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVE
KVAGDIESLLDRKVQALKRLADAAENFQKAHRWQDNIKEEDILYYDAKADAELDDPESED
VERGSKASTLRLDFVEDSNFKNKVNYSYTAVQIPTDIYKGSTVILNELNWTEALENVFIE
NRRQDPTLLWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVD
VSGSVSGLTLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFK
EAVQGMVAKGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWP
NRTVRVFTFSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAG
KEAKQVQWTNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRL
TPNYTLGANGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMI
DGNKGHKQIRTLVKSLDERYVDEVMRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQI
LQVKLPISKLKDFEFLLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTP
DSKQCNNFLLHNLILDTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAADD
WTENPEPFNASFYRRSLDNHGYVFKPPHQDALLRPLELENDTVGILVSTAVELSLGGRTL
RPAVVGVKLDLEAWAEKFKVLASNRTHQDQPQKCGPSSHCEMDCEVNNEDLLCVLIDDGG
FLVLSNQNHQWDQVGRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPR
GVFVPTIADFLNLAWWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGNPEARESSCVMKQ
TQYYFGSVNASYNAIIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEGGRLLQKETHS
QRTARSSVNWCRDRDTGEARISALTTTRRKIPQTAAAELPSRRRWASWSPCSCCSSWACL
LGRSPKSTPTPRAASERPLLPLPRPPRLSPAPPHTPP
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgccggctcggacctgcggcgcctctcggcccggcccggcgcggactgcgctc
ccctggcccggccgcggcccccggcccggccccggcgcccggcgcccgccgtccgggccc
ccgcgcccgctgttgctgctattgccgccgctgctgctgctaccgctgttcgccgccccc
ggcgcctctgcctacagcttcccccagcagcacacgatgcagcactgggcccggcgcctg
gagcaagagatcgatggcgtgatgcggatttttgggggcgtccagcagctccgtgagatc
tacaaggacaaccggaatctgtttgaggtgcaggagaatgagcctcagaagttggtggag
aaggtggcaggagacatcgagagcctgctggacaggaaggtgcaggccctgaagagattg
gccgacgctgcagagaacttccagaaagcccaccgctggcaggacaacatcaaggaggaa
gacatcctgtactatgacgccaaggccgatgctgagctggacgaccctgagagtgaggat
gtggagagggggtccaaggccagcaccctaaggctggacttcgttgaggactcaaacttc
aagaacaaggtcaactactcgtacacggccgtgcagatccccacggacatctacaaaggc
tccactgtcatccttaatgaactcaactggacagaggccctggagaatgtgtttatcgag
aaccgcaggcaggaccccacactgctgtggcaggtctttggcagtgccacaggagtcact
cgctactatccagccaccccatggcgagcccctaagaaaatcgacctgtacgatgtccga
aggagaccctggtatatccagggggcctcgtcgcccaaggacatggtcatcatcgtggat
gtgagcggcagcgtgagtggcctgaccctgaagctgatgaagacgtccgtctgtgagatg
ctggacacgctctctgatgatgactatgtgaacgtggcctcgttcaatgaaaaggcacag
cctgtgtcatgcttcacacacctggtgcaggccaatgtgcgtaacaagaaggtgttcaag
gaagctgtgcagggcatggtggccaagggcaccacaggctacaaggccggctttgagtat
gccttcgaccagctgcagaactccaacatcactcgtgccaactgcaataagatgatcatg
atgttcacggatggtggtgaggaccgcgtgcaggatgtctttgagaaatacaattggccc
aaccggacggtgcgtgtgttcactttctccgtggggcaacacaactacgacgtcacaccc
ctgcagtggatggcctgcgccaacaaaggttactattttgagatcccttccattggagcc
atccgcattaacacacaggaatatctggatgtattgggcaggcccatggtactggcaggc
aaggaggccaagcaggtgcagtggaccaacgtgtatgaggatgcactggggctggggtta
gtggtgacagggaccctccctgttttcaacctgacacaggatggccctggggaaaagaag
aaccagctgatcctgggtgtgatgggcatcgatgtggctctgaatgacatcaagaggctc
actccaaactacacgcttggagctaacggctatgtgtttgccattgacctgaacggctac
gtgttgctgcaccccaacctcaagccccagaccaccaacttccgggagcctgtgactctg
gacttcctggatgctgagctggaggatgagaacaaagaggagatccgtcggagcatgatc
gatggcaacaagggccacaagcaaatcagaacgctggtcaagtccctggacgagaggtac
gtagacgaggtgatgcggaactacacctgggtacctataaggagcaccaactacagccta
gggcttgtgctcccgccctacagcaccttctacctccaagccaacctcagtgaccagatc
ctgcaggtcaagttgccaatcagcaaactgaaggattttgagttcctgctccccagcagc
tttgagtctgaaggacatgttttcattgctcccagagagtattgcaaggacctgaatgcc
tcagacaacaacaccgagttcctgaaaaacttcattgagctcatggagaaagtgactcca
gactccaagcagtgcaacaacttccttctgcacaacctgatcttggacacaggcatcaca
cagcagctggtggagcgtgtgtggcgggaccaggatctcaacacgtacagccttctggcc
gtgttcgctgccactgatggtggcatcactcgcgtattccccaacaaagcagcagatgac
tggacggagaatccagagcccttcaatgccagcttctaccgtcgtagcctggacaaccat
ggctatgtcttcaagcccccgcaccaggacgccctgttaaggccactggagctggagaat
gacacagtgggcatcctcgtcagcacagctgtggagctcagcctgggtggacgcacactg
aggccagcagtggtaggtgttaagctggacctagaggcctgggccgagaagttcaaggtg
ctagccagcaaccgtacccaccaggaccagcctcagaagtgtggtcccagcagccactgt
gagatggactgcgaggttaacaatgaggacctgctctgtgtcctcattgatgatggggga
ttcctggtgctgtcaaaccagaatcatcagtgggaccaggtgggcaggttcttcagtgag
gtggatgccaacctgatgctggcactctacaataactccttctacacccgcaaagagtcc
tacgactatcaggcagcctgcgccccccaacccccaggcaacctgggtgctgcaccccgg
ggggtctttgtgcccactattgcagacttccttaacttggcctggtggacctcggctgca
gcctggtccttgttccagcagcttctctatggcctcatttatcacagctggtttcaggca
gaccccgcggaggctgaggggaaccccgaagcgcgagagagcagctgcgtcatgaaacag
acccagtactacttcgggtcggtgaacgcctcctacaacgccatcatcgactgcggaaac
tgctccaggctgttccacgcgcaaagactgaccaacaccaaccttctcttcgtggtggcc
gagaagcctctgtgcagccagtgtgagggtggccggcttctgcagaaagagacacactcc
cagcggacggcccggagcagtgtgaactggtgcagagaccgcgataccggagaggcccgc
atatctgctttgactacaacgcgacggaagatacctcagactgcggccgcggagcttcct
tcccgccgtcgctgggcgtcctggtctccctgcagctgctgctcctcctgggcttgcctc
ctcggccgcagccccaagtccacgcccacgcctcgcgccgcgtctgagcgccccctcctg
cccctccccaggcctccccgcctctcccctgcccccccccacaccccgccttag

DBGET integrated database retrieval system