KEGG   Felis catus (domestic cat): 101096050Help
Entry
101096050         CDS       T02385                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fca  Felis catus (domestic cat)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fca00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A2
AA seq 561 aa AA seqDB search
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDQLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQHHFEFEYQTKVDGEIILHLYDKGGIEQTVCMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVNLKHSTTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDEPLHALYDNVEKLFPGFELETVKNNLRILFD
NAIKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSTDLLAAR
KVANHIGSEHHEVLFNSEEGIQVLDEVIFSLETYDITTVRASVGMYLVSKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPDMRTPKNGIEKHLLRETFEDSNLIPKDILWRPKEAFSDGITSVKNS
WFRILQEYVEHQVDDTMMATAAQKFPFNTPKTKEGYYYRQIFERHYPGRADWLTHYWMPK
WINATDPSARTLAHYKSAAKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggatttgggccctctttggcagtgatgactgcctttctgttcagtgcctgagt
gctatgaagattgcacacaggggtccagatgcatttcgctttgagaatgtcaatggatac
accaactgctgctttggatttcatcggttggcagtggttgaccagctatttggaatgcag
cccatccgagtgaagaaatatccttatttgtggctttgttacaacggtgaaatctacaac
cacaagaagatgcaacaccattttgaatttgaataccagaccaaagtggatggtgagata
atccttcatctttacgacaaaggaggaattgagcaaacagtttgcatgttggatggggtg
tttgcatttattttgctggatactgccaataagaaagtgttcctgggcagagatacttat
ggagtcaggcctttgtttaaagccatgacggaagatggatttttggctgtgtgttcagaa
gctaaaggtcttgttaacttgaagcactccacaactccttttttaaaagtggagcctttt
ctcccaggacactatgaagttttggatttaaagccaaatggcaaagttgcatcagtggaa
atggtcaaatatcatcactgtagagatgagcccctgcatgcgctctatgacaatgtggag
aaactcttcccaggttttgagctagaaactgtgaagaacaacctccggatcctttttgac
aatgccataaagaaacgcttaatgacagacagaaggattggctgccttttatcagggggc
ttagattccagtttggttgctgccaccctgttgaagcagctaaaagaggctcaagtacag
taccctctccagacatttgcgattggcatggaagacagtactgatttactcgctgctaga
aaggtggcaaatcacattggaagtgaacaccatgaagtcctctttaattctgaagaaggc
attcaggtcctggatgaagtaatattttccttggaaacttatgatattacaacagtacgt
gcttcagtaggtatgtacttagtctccaagtatattcggaagaacacagatagtgtggtg
atcttctctggagaaggttcagatgagcttacgcagggttacatatattttcacaaggct
ccttctcctgaaaaagccgaggaggagagcgagaggcttctgaaggaactctacttgttc
gacgttctgcgggcagatcgcactactgctgcccacggccttgaattgcgcgtccctttc
ctggatcatcgattttcttcctattacttgtctctgcccccagatatgagaactcccaag
aatgggatagaaaaacatctcctgagagagacatttgaggactccaatctaatacctaaa
gacattctctggcggccaaaagaagcattcagtgatggaataacctcggttaagaattcc
tggtttaggattttacaggaatatgttgaacatcaggttgatgatacaatgatggcgact
gcagcccaaaaatttcccttcaatactcctaaaactaaggaaggctattactaccgtcaa
atctttgaacgccactacccaggccgggcagactggctgacccattactggatgcccaag
tggatcaatgccacggacccttctgcccgcactctggcccattacaagtcagccgccaaa
gcctag

DBGET integrated database retrieval system