KEGG   Felis catus (domestic cat): 101096215Help
Entry
101096215         CDS       T02385                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
fca  Felis catus (domestic cat)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101096215 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101096215 (PIK3CG)
   04072 Phospholipase D signaling pathway
    101096215 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    101096215 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    101096215 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101096215 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    101096215 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101096215 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    101096215 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101096215 (PIK3CG)
   05145 Toxoplasmosis
    101096215 (PIK3CG)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101096215 (PIK3CG)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101096215 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
A2
AA seq 1174 aa AA seqDB search
MPPFHCLARPIRVDIHKVPAIALQVAQGMELDNYEQPVVLREDNRRRRRRMKPRSTTASL
SSMELIPIEFVLPTSQRNSKTPETALLHVAGHGNVEQMKAQVWLRALETSVATDFYRRLG
PDHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWQVLHRSPGQIHVVQRRAPSDETLAFQR
QLTALIGYDVTDVSNVHDNELEFTRRRLVTPRMVEVAGRDPKLYAMHPWVTSKPLPEYLL
KKITNNCIFIVIHRSTTSQTIKVSADDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVL
RVCGRDEYLVGETPIKNFQWVRQCLKNGEEIHLVLDTPPDPALDEVRKEEWPLVDDCTGV
TGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNADLTVFVEANIQHGQQ
VLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPRGALLNLQIYCSKAPVLAGKTSAETPSS
ESKGKTQLLYYVNLLLIDHRFLLRHGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKEN
SMSISILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDK
ELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLD
CNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIG
HFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTDQVQVIEMLQKVTLDIKSL
SAEKYDVSSQVISQLKQKLENLQNSNLPKSFRVPYDPGLKAGALVIEKCKVMASKKKPLW
LEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIST
GDRIENQTREIAAWLKSPLPSCQQRPSHSSSGSGPRPQCPSASVHLLIGMIEIVKEATTI
AKIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRH
NDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQK
FQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYF
LDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgtttcattgtctggccagacctatacgtgtggatatccataaggttccggcc
atagctttgcaggtcgcgcagggcatggagctggacaactatgaacagcccgtggttctg
agagaggacaaccgccgccggcgccggaggatgaagccgcgcagcaccacggccagcctg
tcctccatggagctcatccccatcgagttcgtgctgcccaccagccagcgcaacagcaag
acccccgagacggcgctgctgcacgtggccggccacggcaacgtggagcagatgaaggcc
caggtgtggctgcgcgcgctggagactagcgtggcgaccgacttctaccgccggctcggc
ccggaccacttcctcctgctctaccagaagaagggccagtggtatgagatctacgacaag
taccaggtggtgcagaccctggactgcctgcgctactggcaggtgctgcacaggagcccg
ggccagatccacgtggtgcagcggcgcgcgccctccgacgagacgctggccttccagcgg
cagctcaccgccctgatcggctacgacgtcaccgacgtcagcaacgtgcacgataacgag
ctcgagttcacgcgccgccgcctggtcaccccgcgcatggtcgaggtggccggccgcgac
cctaagctctacgccatgcacccgtgggtgacatcgaagcccctcccggagtatctgttg
aagaagatcaccaacaactgcatcttcatcgtcattcaccgcagcaccaccagccagacc
atcaaggtctcggccgatgacaccccaggcgccatcctccagagcttcttcaccaagatg
gccaagaagaagtctctgatggatatccccgaaagccagagcgaacaggattttgtgctc
cgcgtctgcggccgggatgagtacctagtgggtgaaacgcccatcaaaaactttcagtgg
gtgaggcaatgcctcaagaatggagaagagattcacctggtgcttgacacgcctccagac
ccagccctggacgaggtgaggaaagaagagtggccactggtggatgactgcacgggagtc
actggctaccatgagcagctgaccatccacgggaaggaccacgagagtgtgttcaccgtg
tccctgtgggactgtgaccggaagttcagggtcaaaatcagaggcattgatatccccgtc
ctgccccggaatgctgacctcacggtttttgtggaggcaaacatccagcatgggcagcaa
gtcctttgccaaaggagaaccagccccaaacccttcacagaggaggtgctctggaatgtg
tggctcgagttcagtatcaaaataaaagacttacccagaggggctctactcaacctccag
atctactgcagcaaagctccggtgctggctggcaagacctctgcagagactcccagttcc
gagtccaaaggcaaaactcagctcctctattacgtgaacctgctgctgatagaccaccga
ttcctcctgcgccacggggagtatgtgctccacatgtggcagatatctggaaagggagaa
gaccaagggagcttcaatgctgacaagctcacgtctgcgacaaacccagacaaggagaac
tcaatgtccatctccattctcctggacaattactgtcacccaatagccttgcctaagcat
cgccccacccctgaccccgaaggggaccgggttcgagcagaaatgcccaaccagcttcgg
aagcaactggaagcaatcatagccactgatccacttaaccctctcacagcagaggacaaa
gaattgctctggcattttagatatgaaagccttaagcatccaaaggcatatcctaagctg
tttagctccgtaaaatggggacagcaagaaattgtagccaaaacgtaccaattgttagcc
agacgggaggtctgggatcaaagtgctttggatgtggggttaacaatgcaactcctggac
tgcaacttttcagatgaaaatgtaagagccattgcagtgcagaaactggagagcttggag
gacgatgatgttctgcattacctcctacagctggtccaggctgtgaaatttgaaccctat
catgacagcgccctcgccagatttctgctgaagcgtggcttacgaaacaaaagaattggt
cacttcttgttttggttcttgagaagcgagatagcacagtccagacactaccagcagagg
tttgcagtgatcctagaagcctacctgaggggctgtggcacagccatgctgcatgacttc
accgaccaagtgcaagtgatcgagatgctacagaaggtcacccttgatattaaatcgctc
tctgctgaaaagtatgatgtcagttcccaagttatttcacaacttaagcaaaaacttgaa
aacctgcagaattcgaatctcccaaaaagctttagagtcccgtatgatcctggactgaag
gccggagcactagtgattgaaaaatgtaaagtgatggcctccaagaaaaagcccctatgg
cttgagtttaaatgtgccgaccctacagccctatcaaatgaaacgattggcattatcttt
aaacatggtgatgatctgcgccaagacatgctgattttacagattctacgaatcatggaa
tccatttgggagactgaatctctggatctgtgcctcctgccatatggttgcatttcaact
ggtgacagaatagaaaaccaaaccagggaaatagccgcctggttgaaaagccctctgccc
tcctgtcaacagagacccagccattcctcctctgggtcaggccccaggccccagtgtcca
tcagcctctgtacatcttctcataggaatgatcgagatcgtgaaagaggccacgacaatt
gccaaaattcagcaaagcaccgtgggcaacacgggcgcgtttaaagatgaagtcctgaat
cactggctcaaggagaaatgccctattgaagaaaagtttcaggcagcagtggagagattt
gtttattcctgtgctggctactgtgtggctacctttgttcttggaataggcgacaggcac
aacgacaatattatgatcacagagacaggaaatctatttcatattgactttggacacatt
cttgggaattacaaaagttttctgggcatcaataaagagagagtgccatttgtgctaacc
ccagacttcctgtttgtgatgggaacttctggaaagaagacaagcctgcacttccagaaa
tttcaggacgtctgcgttaaggcttacctcgcccttcgtcatcacacaaacctgctgatc
atcctcttctccatgatgctgatgacaggaatgccccagttaacaagcaaagaagatatt
gaatatattcgggatgccctaacagtggggaaaagtgaggaggatgctaagaagtatttt
cttgatcagatcgaagtgtgtagagacaaaggatggaccgtgcagtttaactggttcctg
catcttgttctgggcatcaaacaaggggagaaacattcagcctag

DBGET integrated database retrieval system