KEGG   Felis catus (domestic cat): 101096317Help
Entry
101096317         CDS       T02385                                 

Gene name
GSTA2
Definition
(RefSeq) glutathione S-transferase A2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101096317 (GSTA2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101096317 (GSTA2)
   00982 Drug metabolism - cytochrome P450
    101096317 (GSTA2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101096317 (GSTA2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101096317 (GSTA2)
  Drug resistance
   01524 Platinum drug resistance
    101096317 (GSTA2)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101096317 (GSTA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
B2
AA seq 223 aa AA seqDB search
MAGKPKLHYFNGRGRMESIRWLLASAGVEFEEKFIETPEDLDKLKNDGNLMFQQVPMVEI
DGMKMVQTRAILNYIATKYNLYGKDIKERALIDMYIEGMADLNEMILVLPLCPPDQKEAK
IAQIKEKVTDRYLPVFEKVLKSHGQDYLVGNRLSRADIHLVELLYYVEELDPSLMANFPL
LKALKTRISNLPPVKKFLQPGSQRKPPISEEDLEKARKIFRIK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaagcccaagcttcactactttaatggacgtggcagaatggagtccatccgg
tggctcctggcttcagccggagtagagtttgaagagaaatttatagaaactccagaagac
ttggataagttaaagaatgatggaaatttgatgttccagcaagtgccaatggttgaaatt
gatggaatgaagatggtccagacgagagccattctcaactacattgccaccaaatacaac
ctctatggaaaagacataaaggagagagctctgatagatatgtacatagaaggtatggca
gatttgaatgaaatgatcctcgttttgcctctgtgtccacctgatcagaaagaggccaag
attgcccagatcaaagagaaagtaacagatcgttatctccctgtgtttgaaaaagtgtta
aagagccacggacaagactaccttgttggcaacaggctgagcagggctgacattcacctg
gttgaacttctgtactatgtggaagagcttgaccccagccttatggccaacttccctctg
ctgaaggccctgaagaccagaatcagcaatctccctcccgtgaagaagtttctgcagcct
ggcagccagaggaagcctcctatcagtgaggaagatttagaaaaagcaaggaagattttc
aggattaaatga

DBGET integrated database retrieval system