KEGG   Felis catus (domestic cat): 101096363Help
Entry
101096363         CDS       T02385                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04071  Sphingolipid signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04217  Necroptosis
fca04380  Osteoclast differentiation
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04920  Adipocytokine signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05160  Hepatitis C
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05168  Herpes simplex infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101096363 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101096363 (TRAF2)
   04064 NF-kappa B signaling pathway
    101096363 (TRAF2)
   04668 TNF signaling pathway
    101096363 (TRAF2)
   04071 Sphingolipid signaling pathway
    101096363 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101096363 (TRAF2)
   04217 Necroptosis
    101096363 (TRAF2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    101096363 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    101096363 (TRAF2)
   04657 IL-17 signaling pathway
    101096363 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    101096363 (TRAF2)
  Development
   04380 Osteoclast differentiation
    101096363 (TRAF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101096363 (TRAF2)
   05203 Viral carcinogenesis
    101096363 (TRAF2)
   05222 Small cell lung cancer
    101096363 (TRAF2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096363 (TRAF2)
  Infectious diseases
   05160 Hepatitis C
    101096363 (TRAF2)
   05168 Herpes simplex infection
    101096363 (TRAF2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101096363 (TRAF2)
   05169 Epstein-Barr virus infection
    101096363 (TRAF2)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     101096363 (TRAF2)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101096363 (TRAF2)
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    101096363 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-RING_6 zf-RING_2 MATH Reo_sigmaC SlyX HemX zf-C3HC4_5 DUF1664
Motif
Other DBs
NCBI-GeneID: 101096363
NCBI-ProteinID: XP_006939728
Ensembl: ENSFCAG00000000389
UniProt: M3VUN4
Position
D4
AA seq 523 aa AA seqDB search
MAAASVTPPGSLDVLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSYCLTS
ILSSGPQNCAACVHEGIYEEGISILESGSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGHCPFMLTECPACRGLVRLGEKERHSEQECPERSLSCRHCRAPCCWADLKAHHE
VCPKFPLTCDGCGKKKISREKFQDHVRACGRCRVPCRFRAVGCAEMVESEKQQQHEAQWL
REHLAMLLGGLLEARHPSGADGRFLGQGEVGGWEAGTLHPEAELPKAAELRQRCEALERK
TATFENIVCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMAEL
EQKVHEMEASTFDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNG
DGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQR
PVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccagcgtgacccctcccggctccctagacgtgttgcagcccggcttctca
aagaccctgctggggaccaagccagaggacaagtacctgtgctcggcctgcaggaacgtc
ctgcgcaggcccttccaggcacagtgcggccaccgctactgctcctactgcctgaccagc
atcctgagctccgggcctcagaactgtgccgcctgtgttcacgaaggcatatacgaagag
ggcatttctattttggaaagcggttcggcgttcccggacaacgctgcgcgcagggaggtg
gagagcctgccggccgtgtgtcccagcgacggctgcacctggaaggggacccttaaggag
tatgagagctgccacgaaggacactgcccgttcatgctgaccgagtgcccggcgtgcaga
ggcctggttcgcctcggggagaaggagcggcactcggaacaagagtgcccggagaggagc
ctcagctgcaggcactgccgggcgccctgctgctgggccgacctgaaggcgcaccacgaa
gtctgccccaagttccccctgacctgtgacggctgtggcaagaagaagatctcccgcgag
aaattccaggaccacgtccgggcatgtggcagatgccgagtcccgtgcaggttccgtgct
gtcggctgcgccgagatggtggagagtgagaagcagcagcagcacgaggcccagtggctc
cgggagcacctggccatgctgctgggcggcctcctggaggccaggcacccgtcgggggcc
gatggccgcttcctgggccaaggcgaggtcgggggctgggaggccggcacgctgcacccc
gaggccgagctccccaaggccgcggagctccggcagcggtgtgaggccctggagaggaag
acggccactttcgagaacatcgtctgcgtcctgaaccgggaggtggagagggtggccatg
accgccgaggcctgtggccggcagcaccgactggaccaggacaggatcgaggccctgagt
aacaaggtgcagcagctggagaggagcatcggcctgaaggacctggccatggccgagctg
gagcagaaggtccacgagatggaggcgtccaccttcgacggcgtgtttatctggaagatc
tcggatttcgccaggaagcgccaggaagctgtggctggccgcacgcccgccatcttctct
ccagccttctacacgagcaggtacggctacaagatgtgtctgcgcatctacctgaacgga
gatggcaccgggcgcgggacgcacctgtctctcttctttgtggtgatgaagggccccaac
gacgccctcctgcggtggcccttcaaccaaaaggtgaccttaatgctgcttgaccagaac
aaccgggagcatgtgatcgacgcctttagacccgacgtgacctcgtcctccttccagagg
ccagtcagtgacatgaacatcgcgagcggctgccccctcttctgccccgtttccaagatg
gaggccaagaattcctacgtgcgcgatgacgccatcttcatcaaggccattgtggacctg
acggggctctag

DBGET integrated database retrieval system