KEGG   Felis catus (domestic cat): 101096363Help
Entry
101096363         CDS       T02385                                 

Gene name
TRAF2
Definition
TNF receptor-associated factor 2
Orthology
K03173  
TNF receptor-associated factor 2
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Osteoclast differentiation
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101096363 (TRAF2)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101096363 (TRAF2)
   04064 NF-kappa B signaling pathway
    101096363 (TRAF2)
   04668 TNF signaling pathway
    101096363 (TRAF2)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101096363 (TRAF2)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    101096363 (TRAF2)
  Endocrine system
   04920 Adipocytokine signaling pathway
    101096363 (TRAF2)
  Development
   04380 Osteoclast differentiation
    101096363 (TRAF2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101096363 (TRAF2)
   05203 Viral carcinogenesis
    101096363 (TRAF2)
   05222 Small cell lung cancer
    101096363 (TRAF2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096363 (TRAF2)
  Infectious diseases
   05160 Hepatitis C
    101096363 (TRAF2)
   05168 Herpes simplex infection
    101096363 (TRAF2)
   05169 Epstein-Barr virus infection
    101096363 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 523 aa AA seqDB search
MAAASVTPPGSLDVLQPGFSKTLLGTKPEDKYLCSACRNVLRRPFQAQCGHRYCSYCLTS
ILSSGPQNCAACVHEGIYEEGISILESGSAFPDNAARREVESLPAVCPSDGCTWKGTLKE
YESCHEGHCPFMLTECPACRGLVRLGEKERHSEQECPERSLSCRHCRAPCCWADLKAHHE
VCPKFPLTCDGCGKKKISREKFQDHVRACGRCRVPCRFRAVGCAEMVESEKQQQHEAQWL
REHLAMLLGGLLEARHPSGADGRFLGQGEVGGWEAGTLHPEAELPKAAELRQRCEALERK
TATFENIVCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAMAEL
EQKVHEMEASTFDGVFIWKISDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRIYLNG
DGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQR
PVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccagcgtgacccctcccggctccctagacgtgttgcagcccggcttctca
aagaccctgctggggaccaagccagaggacaagtacctgtgctcggcctgcaggaacgtc
ctgcgcaggcccttccaggcacagtgcggccaccgctactgctcctactgcctgaccagc
atcctgagctccgggcctcagaactgtgccgcctgtgttcacgaaggcatatacgaagag
ggcatttctattttggaaagcggttcggcgttcccggacaacgctgcgcgcagggaggtg
gagagcctgccggccgtgtgtcccagcgacggctgcacctggaaggggacccttaaggag
tatgagagctgccacgaaggacactgcccgttcatgctgaccgagtgcccggcgtgcaga
ggcctggttcgcctcggggagaaggagcggcactcggaacaagagtgcccggagaggagc
ctcagctgcaggcactgccgggcgccctgctgctgggccgacctgaaggcgcaccacgaa
gtctgccccaagttccccctgacctgtgacggctgtggcaagaagaagatctcccgcgag
aaattccaggaccacgtccgggcatgtggcagatgccgagtcccgtgcaggttccgtgct
gtcggctgcgccgagatggtggagagtgagaagcagcagcagcacgaggcccagtggctc
cgggagcacctggccatgctgctgggcggcctcctggaggccaggcacccgtcgggggcc
gatggccgcttcctgggccaaggcgaggtcgggggctgggaggccggcacgctgcacccc
gaggccgagctccccaaggccgcggagctccggcagcggtgtgaggccctggagaggaag
acggccactttcgagaacatcgtctgcgtcctgaaccgggaggtggagagggtggccatg
accgccgaggcctgtggccggcagcaccgactggaccaggacaggatcgaggccctgagt
aacaaggtgcagcagctggagaggagcatcggcctgaaggacctggccatggccgagctg
gagcagaaggtccacgagatggaggcgtccaccttcgacggcgtgtttatctggaagatc
tcggatttcgccaggaagcgccaggaagctgtggctggccgcacgcccgccatcttctct
ccagccttctacacgagcaggtacggctacaagatgtgtctgcgcatctacctgaacgga
gatggcaccgggcgcgggacgcacctgtctctcttctttgtggtgatgaagggccccaac
gacgccctcctgcggtggcccttcaaccaaaaggtgaccttaatgctgcttgaccagaac
aaccgggagcatgtgatcgacgcctttagacccgacgtgacctcgtcctccttccagagg
ccagtcagtgacatgaacatcgcgagcggctgccccctcttctgccccgtttccaagatg
gaggccaagaattcctacgtgcgcgatgacgccatcttcatcaaggccattgtggacctg
acggggctctag

DBGET integrated database retrieval system