KEGG   Felis catus (domestic cat): 101096371Help
Entry
101096371         CDS       T02385                                 

Gene name
CTRB1
Definition
chymotrypsinogen B1
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101096371 (CTRB1)
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101096371 (CTRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E2
AA seq 240 aa AA seqDB search
MALLPVVLGFLLFGSSSGCGVPAIHPELSGLSRIVNGEDAVPSSWPWQVSLQTRSGFHFC
GGSLISQHWVVTAAHCRVRKSHRVVAGVSDHGSDEEAVQVLRITEVFEYPLWDQVSGRND
IALLKLATPALLSTTASPVCLPSANTSFPAGSLCATTGWGKTRYNYLRRALVSSSPPLSL
GRESDVRGDSGGPLVCQKDGAWTLVGIVSWGSDWCNPFSPGVYTRVTKFISWVLGVLEAN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcccttctcccggttgtccttggcttcctcctctttggcagcagttctggctgtggg
gtccctgccatccaccctgagctgagtggcctgtcccggatcgtcaatggagaggatgcg
gtccccagctcctggccctggcaggtgtccctgcagactcgctccggcttccacttctgc
gggggctccctcatcagccagcactgggtcgtcactgctgcccactgcagggtcaggaag
agccaccgtgtggtggctggggtgtctgatcacggctctgacgaggaggctgtccaggtg
ttgaggatcactgaggtgtttgaatacccactgtgggaccaggtttccggccgcaacgac
atcgccctgctgaagctggccacaccggccctgctctcaacaaccgcgtcccccgtctgc
ctgcccagtgccaacaccagcttccctgccggctccctctgcgccaccaccggctggggc
aagacccggtataactacttgaggcgggcgcttgtgtcaagctcgccgccgttaagtctg
ggccgggagtcagatgtccggggcgactctggcggccccctggtctgccagaaggacgga
gcctggaccctggtgggcatcgtgtcctggggcagcgactggtgtaacccattctcaccg
ggggtgtacacccgtgtcaccaagtttatttcctgggttctcggggttctggaggccaat
tga

DBGET integrated database retrieval system