KEGG   Felis catus (domestic cat): 101096382Help
Entry
101096382         CDS       T02385                                 

Gene name
USP11
Definition
ubiquitin specific peptidase 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 951 aa AA seqDB search
MAVDPRLFGGLCFRFRDQNPEVAVEGPLPISSCGGWERRRTVMAAVAANVAAAAEDQEPQ
HEAVPGLESQWLQIENKESGRDRPLRAGESWFLVEQHWYKQWEVYVQGGDKDSTAFPGCI
NNADLFEDQVNWRLKRGLVESEDYVLLPAAAWHCLVDWYGLEHGQPPIERKVVELLGIQK
VEVYPVELLLVRHSDMDTPYTAQFSHTDSVDLVLRTAREQFLVNPQEETRLWIKNAEGSF
ERLCNTRVTLLEAALQTGQLIIMETRNKDGTWPSAQQQAVSTASEEDEEFQGQPGICGLT
NLGNTCFMNSALQCLSNVPQLTDYFLKNRYLEELNFCNPLGMKGEIAEAYADLVKQAWSG
HHRSIVPHVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAG
RPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVSH
KRVMEVFFVSMDPRRKPEQHRLVVPKKGKISDLCVALAKHTGVSPERMMVADVFSHRFYK
IYQLEESLSSILDRDDIFIYEVSGRSAIGDNSREDVVLPIYLRERTPARDYNNSYYGLML
FGHPLLVSVPRDRLSWDALYHILLYRLSRYVTRPSSDDEDDGDEKDMEDKDSIPKPGRVA
GGSSQDSGPEQAGPSSGVAGGSRAPVDNSPGPSHWPQRARRKHLFTLQTVNSNGTSDRST
FNEDTHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVLKKAPVRLQECIELFTTVE
TLEKENPWYCPTCKQHQLATKKLDLWMLPETLIIHLKRFSYTKFSREKLDTLVEFPIRDL
DFSEFVIKPQNESAPELYKYDLIAVSNHYGGLRDGHYTTFACNKDSGQWHYFDDNSVSPV
TENQIESKAAYVLFYQRQDVARRQQPQPGLRDPPASPACGSPPNSEFMDVN
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagacccccggctatttggggggctctgtttccgtttccgggaccagaatccg
gaagtggcagttgaggggcctcttcctatctccagctgcggtggttgggagaggaggcga
acggtgatggcggcggtcgcagcgaatgtagcggctgcggccgaggaccaagagccacaa
cacgaagcggtgccgggcctggagagccagtggctccagatcgagaataaggagagtggg
cgagatcgtccactgcgggccggggaaagctggttcctcgtggagcagcactggtacaag
cagtgggaagtgtatgtgcagggaggagacaaggactccaccgccttccctggctgcatc
aataatgctgacctctttgaagaccaggtaaactggcgcctcaagcggggactagtggaa
agtgaggactatgtgctgctcccagcggctgcttggcattgcctggtcgactggtatggt
ctagagcatggccagccccccattgaacgcaaggtcgtggagctgctcggcatccagaag
gtcgaggtgtatccagtagaactgctgcttgtccggcacagtgatatggacacaccttac
acggctcaattcagccatacagattccgttgacctagttttgcgcaccgcccgagagcaa
tttctggtgaatccccaggaagagacaaggctgtggatcaagaacgcggagggctctttt
gagaggttgtgcaacacccgcgtcacactcctcgaggctgccctccagactgggcagttg
atcatcatggagacccgaaacaaggacggcacttggcccagtgcccagcaacaggccgtg
agcactgcatcggaggaggatgaagaattccagggccagccaggcatctgtggtctcacc
aacctgggcaacacgtgcttcatgaactcggccctgcagtgcctcagcaacgtgccgcag
ctcaccgactacttcctcaaaaaccgctacctggaggaactcaacttctgcaacccactg
ggcatgaagggggagatcgcagaggcctacgcagacctggtgaagcaggcctggtccggc
caccaccggtccatcgtgccccatgtgttcaagaccaaggtcggccacttcgcgtcccag
tttctgggctaccagcagcatgactcacaggagctgctgtcattcctcctggatgggctg
catgaggacctcaatcgtgtcaagaagaaggaatatgtggagctgtgcgacgcggccggc
cggccagatcaggaggtggctcaggaggcctggcagaaccacaaacggcggaacgattct
gtgattgtggacaccttccacggtctcttcaagtccacgctggtgtgccccgattgtggc
aatgtgtctgtgaccttcgaccccttctgctacctcagtgtccctctgcctgtcagccac
aagagggtcatggaggtcttctttgtctccatggaccctcgccgcaagccagagcagcac
cggctcgtggtccccaagaaaggcaagatctcggatctgtgtgtggctctggccaaacac
accggcgtgtcgccagaaaggatgatggtggccgatgtcttcagtcaccgtttctataag
atctaccagctggaggagtctctgagcagcatcttggaccgagatgatatcttcatatac
gaggtgtcgggcaggtctgctattggtgacaactcgagagaggacgtggtgctccccatc
tacctgcgggagcgcacgccagcccgggattacaacaactcctactacggcctgatgctc
ttcgggcacccgctcctggtgtcggtgccccgtgaccggctctcctgggatgccctgtat
cacatcctgctgtaccgcctctcgcgctacgtgaccagacccagctcggatgacgaagac
gacggggacgagaaagatatggaggacaaggacagcatccccaagcccggacgcgtggct
gggggcagctcccaggattccgggccggagcaggcagggcctagctctggagtggcaggc
gggagccgcgcccctgtggacaactcccctggaccatctcactggccccagagggcacgg
cgcaagcacctgttcaccctgcagacggtgaactccaacgggaccagcgaccgctcaacc
ttcaacgaggatacccatgcccagccgtacatcgccatcgactgggagccagagatgaag
aagcgttactatgacgaggtggaggccgagggctacgtgaagcacgactgtgtggggtac
gtgctgaagaaggcgccggtgcggctgcaggagtgcattgagctgttcaccaccgtggag
actttggagaaggaaaacccctggtactgtcccacctgcaagcagcaccagctggccacc
aagaagctggacctgtggatgctgcctgagacactcattatccacctgaagcgcttctct
tacaccaagttctcccgcgagaagctggatacccttgtggagtttcccatccgggacctg
gacttctccgagtttgtcatcaagccgcagaacgagtcggctccggagctgtacaaatac
gatctcatcgcggtttccaaccattacgggggcctgcgtgacggacactacacgacgttt
gcctgcaacaaggacagcggccagtggcactactttgacgacaacagcgtgtcgcccgta
accgagaatcagatcgagtccaaggcagcctatgtcctcttctaccaacgccaggatgtg
gcacgtcgccagcagccccagcccggcttacgtgaccccccagcgtcccctgcctgcggt
tccccacccaactctgagttcatggatgtaaactga

DBGET integrated database retrieval system