KEGG   Felis catus (domestic cat): 101096382Help
Entry
101096382         CDS       T02385                                 

Gene name
USP11
Definition
ubiquitin specific peptidase 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101096382 (USP11)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101096382 (USP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 1023 aa AA seqDB search
MSSFISGTSASTFPHNLLPRLNMALESYKTPLSLLVPNWRFYPAYWPQRSPPTQSRCPPS
HSTRPSAGSLSKMAVDPRLFGGLCFRFRDQNPEVAVEGPLPISSCGGWERRRTVMAAVAA
NVAAAAEDQEPQHEAVPGLESQWLQIENKESGRDRPLRAGESWFLVEQHWYKQWEVYVQG
GDKDSTAFPGCINNADLFEDQVNWRLKRGLVESEDYVLLPAAAWHCLVDWYGLEHGQPPI
ERKVVELLGIQKVEVYPVELLLVRHSDMDTPYTAQFSHTDSVDLVLRTAREQFLVNPQEE
TRLWIKNAEGSFERLCNTRVTLLEAALQTGQLIIMETRNKDGTWPSAQQQAVSTASEEDE
EFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTDYFLKNRYLEELNFCNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKTKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPVSHKRVMEVFFVSMDPRRKPEQHRLVVPKKGKISDLCVALAKHTGVSPERM
MVADVFSHRFYKIYQLEESLSSILDRDDIFIYEVSGRSAIGDNSREDVVLPIYLRERTPA
RDYNNSYYGLMLFGHPLLVSVPRDRLSWDALYHILLYRLSRYVTRPSSDDEDDGDEKDME
DKDSIPKPGRVAGGSSQDSGPEQAGPSSGVAGGSRAPVDNSPGPSHWPQRARRKHLFTLQ
TVNSNGTSDRSTFNEDTHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVLKKAPVR
LQECIELFTTVETLEKENPWYCPTCKQHQLATKKLDLWMLPETLIIHLKRFSYTKFSREK
LDTLVEFPIRDLDFSEFVIKPQNESAPELYKYDLIAVSNHYGGLRDGHYTTFACNKDSGQ
WHYFDDNSVSPVTENQIESKAAYVLFYQRQDVARRQQPQPGLRDPPASPACGSPPNSEFM
DVN
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgttcatatcggggacctctgcctccacctttccacacaaccttttgccccga
ctcaacatggcgttagaatcctacaagacacctttgtctttattagttcccaactggagg
ttttaccccgcctattggccgcagaggtcaccgcccactcagtcccgatgcccgcctagc
cactccacgcgtccgagcgcggggtccctttccaagatggcagtagacccccggctattt
ggggggctctgtttccgtttccgggaccagaatccggaagtggcagttgaggggcctctt
cctatctccagctgcggtggttgggagaggaggcgaacggtgatggcggcggtcgcagcg
aatgtagcggctgcggccgaggaccaagagccacaacacgaagcggtgccgggcctggag
agccagtggctccagatcgagaataaggagagtgggcgagatcgtccactgcgggccggg
gaaagctggttcctcgtggagcagcactggtacaagcagtgggaagtgtatgtgcaggga
ggagacaaggactccaccgccttccctggctgcatcaataatgctgacctctttgaagac
caggtaaactggcgcctcaagcggggactagtggaaagtgaggactatgtgctgctccca
gcggctgcttggcattgcctggtcgactggtatggtctagagcatggccagccccccatt
gaacgcaaggtcgtggagctgctcggcatccagaaggtcgaggtgtatccagtagaactg
ctgcttgtccggcacagtgatatggacacaccttacacggctcaattcagccatacagat
tccgttgacctagttttgcgcaccgcccgagagcaatttctggtgaatccccaggaagag
acaaggctgtggatcaagaacgcggagggctcttttgagaggttgtgcaacacccgcgtc
acactcctcgaggctgccctccagactgggcagttgatcatcatggagacccgaaacaag
gacggcacttggcccagtgcccagcaacaggccgtgagcactgcatcggaggaggatgaa
gaattccagggccagccaggcatctgtggtctcaccaacctgggcaacacgtgcttcatg
aactcggccctgcagtgcctcagcaacgtgccgcagctcaccgactacttcctcaaaaac
cgctacctggaggaactcaacttctgcaacccactgggcatgaagggggagatcgcagag
gcctacgcagacctggtgaagcaggcctggtccggccaccaccggtccatcgtgccccat
gtgttcaagaccaaggtcggccacttcgcgtcccagtttctgggctaccagcagcatgac
tcacaggagctgctgtcattcctcctggatgggctgcatgaggacctcaatcgtgtcaag
aagaaggaatatgtggagctgtgcgacgcggccggccggccagatcaggaggtggctcag
gaggcctggcagaaccacaaacggcggaacgattctgtgattgtggacaccttccacggt
ctcttcaagtccacgctggtgtgccccgattgtggcaatgtgtctgtgaccttcgacccc
ttctgctacctcagtgtccctctgcctgtcagccacaagagggtcatggaggtcttcttt
gtctccatggaccctcgccgcaagccagagcagcaccggctcgtggtccccaagaaaggc
aagatctcggatctgtgtgtggctctggccaaacacaccggcgtgtcgccagaaaggatg
atggtggccgatgtcttcagtcaccgtttctataagatctaccagctggaggagtctctg
agcagcatcttggaccgagatgatatcttcatatacgaggtgtcgggcaggtctgctatt
ggtgacaactcgagagaggacgtggtgctccccatctacctgcgggagcgcacgccagcc
cgggattacaacaactcctactacggcctgatgctcttcgggcacccgctcctggtgtcg
gtgccccgtgaccggctctcctgggatgccctgtatcacatcctgctgtaccgcctctcg
cgctacgtgaccagacccagctcggatgacgaagacgacggggacgagaaagatatggag
gacaaggacagcatccccaagcccggacgcgtggctgggggcagctcccaggattccggg
ccggagcaggcagggcctagctctggagtggcaggcgggagccgcgcccctgtggacaac
tcccctggaccatctcactggccccagagggcacggcgcaagcacctgttcaccctgcag
acggtgaactccaacgggaccagcgaccgctcaaccttcaacgaggatacccatgcccag
ccgtacatcgccatcgactgggagccagagatgaagaagcgttactatgacgaggtggag
gccgagggctacgtgaagcacgactgtgtggggtacgtgctgaagaaggcgccggtgcgg
ctgcaggagtgcattgagctgttcaccaccgtggagactttggagaaggaaaacccctgg
tactgtcccacctgcaagcagcaccagctggccaccaagaagctggacctgtggatgctg
cctgagacactcattatccacctgaagcgcttctcttacaccaagttctcccgcgagaag
ctggatacccttgtggagtttcccatccgggacctggacttctccgagtttgtcatcaag
ccgcagaacgagtcggctccggagctgtacaaatacgatctcatcgcggtttccaaccat
tacgggggcctgcgtgacggacactacacgacgtttgcctgcaacaaggacagcggccag
tggcactactttgacgacaacagcgtgtcgcccgtaaccgagaatcagatcgagtccaag
gcagcctatgtcctcttctaccaacgccaggatgtggcacgtcgccagcagccccagccc
ggcttacgtgaccccccagcgtcccctgcctgcggttccccacccaactctgagttcatg
gatgtaaactga

DBGET integrated database retrieval system