KEGG   Felis catus (domestic cat): 101096383Help
Entry
101096383         CDS       T02385                                 

Gene name
HDAC8
Definition
histone deacetylase 8
Orthology
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
fca  Felis catus (domestic cat)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:fca05203]
Human Diseases; Substance dependence; Alcoholism [PATH:fca05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 415 aa AA seqDB search
MLTREHRCGRSEEQEQEPGLSLKKAGSRRWLRNGWNWKMEEPEEPADSGQSLPPVYIYSP
EYVSMCDSLAKVPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKV
SQEGDDDHPDSVEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGMCKVAINWSGGWH
HAKKDEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHK
FSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKEVYIAFNPKAVVL
QLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLILGGGGYNLANTARCWTYLTGVI
LGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRVQQILNYIKGNLKHVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagggagcaccgctgcggccgttcagaggagcaggaacaggagcccgggctg
agtctgaaaaaagccggatccagaaggtggctccggaacggctggaattggaagatggag
gagccggaggaaccggcggacagtggacagtcgctgcctccagtgtacatctacagtccc
gagtatgtcagcatgtgcgactccctggccaaagtccccaaacgggccagtatggtacat
tctttgattgaagcatatgcactgcataagcaaatgaggatagttaagcccaaagtagcc
tccatggaggagatggccaccttccacactgatgcctatctgcagcatctccagaaggtc
agccaagaaggagatgacgatcatccagactccgtagaatacgggctaggttatgactgt
ccagccactgaagggatatttgactacgcagcagctgtaggaggggctacaatcacagct
gcccaatgcctgattgatggaatgtgcaaagtagcaattaactggtccggagggtggcat
catgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtcctgggaata
ttacgattgcgacggaaatttgaccgtattctctatgtggatttggatctgcaccatgga
gatggtgtagaagatgccttcagtttcacctctaaagtcatgacagtgtccctacacaaa
ttctccccaggatttttcccaggaacaggtgacgtgtctgatgttggcttaggaaaggga
cggtactacagtgtaaatgtgcccattcaggatggcatacaggatgagaagtattaccac
atctgtgaaagtgtactaaaggaggtatacatagcctttaatcctaaagcagtggtctta
cagctgggagctgatacaattgctggggatcccatgtgctcctttaacatgactccagtg
ggaattggcaaatgtcttaagtacatccttcagtggcaattggcaacactcattttggga
ggaggaggctataaccttgccaacacggctcgatgctggacatacttgaccggggtcatc
ctagggaaaacactatcctctgagatcccagatcatgagtttttcacagcatatggtcct
gattatgtgttggaaatcacgccaagctgccggccagaccgcaatgagccccaccgagtc
cagcaaatcctcaactacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system