KEGG   Felis catus (domestic cat): 101096419Help
Entry
101096419         CDS       T02385                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101096419 (SETD1B)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101096419 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D3
AA seq 1864 aa AA seqDB search
MSSNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENF
LRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVEL
DTKGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGSLSAGCGS
GSSSVTPNSGGTPFSQDTAYSSSRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSY
LFSQDPTVTFKARRHESKFTDAYNRRHEHHYVHNSCAVTAVAGAPAAFRGSVDLPFGAVS
SSGGSSGPPFKAQPQDSATFAHTPPPAQATPAPGVTFKSAFSPYQTPVPPFPPPPEEPTT
TTTFGARESGEFRRAPAPPPLPPTEPLTKEKPGTPPGPPPPDANSMELGGRPTFGWSPEP
CDSPGTPTLESSPAGLEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTELQMEGSPISSS
SSQLSPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDDELDLGVGPRPPP
EPGPPDPSGLLGQTTEVALDLAGDRTPTSEKMDEGQQSSGEDMEISDDEMPSAPITSADC
PKPMVVTPGAAAVAAPSVLVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQ
MQTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQPWPP
LPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEW
WDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGA
IRLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAPCELAKRDPKG
VGVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASDKEERESTEEE
EEGEEEEEEEEDEEEEEEEEEEGPRSQVSSSSTSSTSDKDDDAEDSDEQEESENEDEDIA
LSEASEKEEGDSDGEETVSIATSKAGAGSSSESSESSEFESSSESSSSSSEDEEELVARE
EEEEEEEEEEEQEEETTAADESMAPAAPDEDFEEDVATGAPVTESSVMEGEVDIEAEDGA
PEERTSVLEEPPLPVCVEELAGCKEPSEEPGLKQEGARLLSPEPPAGETEARPPPSPEPA
PEDDLEVAPESPTLLSLPLQPPLPPPRPPRPPSPPPEPETPEPPHPPVPLEPPPEEQPPR
TPGLCGSLAKSQSTETVPATPSGEPPLSGGSSGLSLSSPQVPGSPFSYPSQSPSLSSGGL
PRTPGRDFTFTPTFPEPGGPLLLPVCPLPAGRRDERSGPLTSPVLLETGLPLPLPLPLPL
PLALPVPVLRAQTRAPTQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGPLVRPPG
GATLGRDLLLLPGQPQTPVFPSTHDPRAVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEP
TKLPFKELENQWPSEAIPPGPRGRDEVTEEFMDLAKVRGPWRRPPKKRHEDLVASASPEL
SPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYH
PSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMS
IPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLF
AMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFAR
FINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCR
GTLN
NT seq 5595 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaccgcccggtggaaattgtcgaagatccccgggtcgttgggatctggacc
aaaaacaaggagctggagctgtcggtgcccaaattcaagatcgatgagttctacgtgggc
ccggtgcctccgaagcaggtgacatttgccaagctgaatgataacatccgagaaaacttc
ctgagggacatgtgcaagaagtatggggaggtggaggaggtggagattttgtacaaccct
aagaccaagaagcacttgggcattgccaaggtggtctttgccacggtcaggggagccaaa
gaggcggttcagcacctgcatagcacttcggtcatgggcaatatcatccacgtggagctg
gacactaaaggggaaacccgcatgcggttctacgaactgttggtcacgggccgatacaca
ccccagaccctcccagtgggtgagctggacgctgtctctccgatcgtgaatgagaccctg
cagctgtcagatgctctgaagcgcctcaaggatggtagtctgtctgcaggctgtggctcc
ggctcctcctcggtcacccccaatagtggtgggacacccttctcgcaggacacggcgtac
tccagcagccgcctggacacccccaactcctacggacagggcacaccgctcacgccacgt
ctgggcacccccttctcgcaggactccagctactccagccgccagcccacaccctcctac
ctcttcagccaggaccccacggtgaccttcaaggcccggcgccacgaaagcaagttcaca
gatgcctacaaccgccgccacgagcatcactatgtccacaactcctgtgcggtcaccgca
gtggccggggccccagctgccttcaggggctccgtggacctcccgtttggggcagtcagc
agcagcgggggcagcagtggccctccattcaaggcccaaccacaggattcggccacgttc
gcccacactccaccgcctgcccaagcaacccccgctcctggagtcacgttcaagtcggct
ttctctccgtatcagacccctgtgccccctttccccccaccccctgaggagcccaccacc
acaaccacctttggggcccgtgagagtggggaattccggagagcacctgcgcccccaccc
ctgccacccaccgaacccctgaccaaggagaagccaggcacaccgcccggcccaccgccc
cctgatgccaacagcatggagctgggtggccggccgacctttggctggagccctgagcct
tgtgacagtccaggcacacctacgctggagtcctcacctgcggggctggagaagccccac
gacagcctggattcacgcatagagatgctgctgaaggaacagcgcaccaagctgcccttc
cttcgagagcaggactcggatacggagctgcagatggagggcagccccatctcctcctcc
tcctcccagctctccccactggccccctttggcaccaactcccagccaggctttcgaggc
cccacgccaccctcctcacgcccctccagcaccggcctggaggatatcagccccacgccg
ctacccgactcagacgaggatgatgagcttgacctgggcgtggggccccgcccccctccg
gagccaggccccccggacccttctggtcttctgggccagacaactgaggtagccttggac
ctggctggagacaggaccccaacctcagagaagatggatgagggccagcagtcctcgggc
gaggacatggaaatctcggacgatgagatgccctcagcccccatcaccagcgccgactgc
cccaaacccatggtggtgaccccaggggcggcagctgtggcagccccctctgtgctggtc
ccacccccacccatcctaccaccgctgccgcccttccctccagggctgtttcccgtgatg
caggtggacatgagccacgtgctgggtggccagtggggcggcatgcccatgtccttccag
atgcaaacgcagatgctgagccgtctgatgactggccagggcgcctgcccctacccgccc
ttcatggccgctgctgccgcggccgcctcagccgggctgcagtttgtcaacctgccaccc
taccggggcccgttctccctgagcaacagcggaccgggccgcgggcagccctggccaccg
ctacccaagtttgacccatcagtgccgccaccaggctacgtgccacgccaggaggaccca
cacaaggccactgtggatggcgtcctgctggtggtgctcaaagagctgaaggccatcatg
aagcgtgacctgaaccgcaagatggtggaggtggtggctttccgcgccttcgacgagtgg
tgggacaagaaggagcggatggccaaggcctctctgaccccagtgaagtcaggcgagcac
aaggacgaggacaggccaaagcccaaggaccgcatcgcctcgtgcctgctggagtcgtgg
ggcaagggcgagggcctgggctatgagggcctcggcctgggcatcgggctgcgcggggcc
atccgcctgccctccttcaaggtcaagaggaaggagccgccggacacagcctcttctggt
gaccagaagcgcctgcggccctcaacctctgtggacgaggaagatgaagagtcagagcga
gaacgggaccgggatatggcggacgccccttgtgagcttgccaagcgggaccccaagggc
gtgggcgtgcggcgccggccagcccggccgctggagctggacagtggcggggaggaggat
gagaaggagtcactgtcggtgtcctcatcgtcatcggcgtcctcatcctcgggctcctcc
acgacctcaccctcatcctcggcctccgacaaggaggagcgggaaagcactgaggaggaa
gaagagggggaggaggaggaggaggaggaggaggatgaagaggaggaagaggaggaggag
gaggaaggccccaggagccaggtctcctcctcctcgacctcatccacatcagataaggat
gatgacgctgaagacagcgatgagcaggaggagtctgagaatgaggacgaggacatagcc
ctgtcagaggcgagtgagaaggaagaaggggactcggacggagaggagacggtgagcatc
gccacgtccaaggcgggagctgggtcctccagcgagagttctgagtcttctgagtttgaa
tcaagctccgagtcctcgtcgtcatcctcagaggatgaagaggagctggtggcaagggag
gaggaggaggaggaagaggaggaggaggaggagcaggaggaggagaccacagcagcagac
gagagtatggctcctgctgctcccgatgaggactttgaggaggatgtggccacgggggca
cctgtgacagagtcctcggtcatggaaggggaggtggacatcgaggctgaggacggagct
cccgaggagcggacttccgtgctggaagagccccccttgcctgtgtgtgtcgaagagctg
gcaggctgcaaggagccctcggaggagccgggcctgaagcaagaaggggccaggttgctg
tctccagagccccctgctggagagacggaggcccggcccccgccttccccggaacctgcc
ccagaggatgacctggaagtggcgcccgagtcccctacgctgctctccttaccactgcag
ccgccattgccaccccctcgaccaccccggccgcctagcccaccgccagagcccgagacc
ccagagcccccacacccacccgtccctctggagccgcctcccgaggagcagcccccgcgt
actccgggtctctgtggcagcctggccaagtcacagagcacagagacggtgccggccacg
ccaagcggggagcccccgctgtcagggggtagcagtggcctgtcactgagctccccgcag
gtgcccggcagccccttctcctacccatcccagtcccccagcttgagcagcgggggcctc
ccgaggacacctggtcgggacttcaccttcacgcccaccttccctgagcccggcggacct
ctgctcctgcctgtctgtcccctcccagctggccggcgcgatgagcggtctggccccctg
acctccccggtgctcctggagacgggcctgcctctccccctgcccttgcccttgcccctg
cccctggcattgcccgtccctgtcctgcgggcccagacgcgggcccccacccagctgccg
cccctgctgcctgcgcccctggccccctgcccaccccctatcaagaggaagccgggcagg
ccccggcgatccccgccggctgtgctctccttggatgggcccttggtccggccaccaggg
ggggccaccctcggcagagacctcctgctcctgccaggccagccacagacccctgtcttc
cccagcacccatgacccccgggccgtgaccctggacttccggaacgcggggatcccggcc
ccccctccccctctgcccccccagcctcctccgcccccacctccaccccctgttgagcct
accaagctgccctttaaggagctagagaaccagtggccctccgaggccatccctccaggc
ccccgtgggcgcgatgaggtcaccgaggagttcatggacctggccaaggttcgggggccc
tggcgccggccgcctaaaaagcgccacgaggacctggtggcctcagcctcgcccgagctc
tcaccaccgcagcccctcttccggccccggtcggagtttgaggagatgaccatcctgtac
gacatctggaacggtggcatcgacgaggaggacatccgcttcctgtgtgtcacttacgag
cggctgctacagcaggacaatggcatggactggctcaacgacacactctgggtctaccat
ccctccaccagcctctcttcagctaagaaaaagaaacgggacgatggcatccgtgagcac
gtgacgggctgtgcccgcagcgagggtttctacaccatcgacaagaaggacaagctcaga
tacctcaacagcagccgcgccagcaccgatgagcccccgacagacacccagggcatgagc
atcccggcacagccacacgcctccactcgggccggctcggagcggcgttctgaacagcgc
cgcctcctgtcctccttcactggcagctgtgacagtgacctgctcaagttcaaccagctc
aagttccggaagaagaagctcaaattctgcaagagccacattcacgactggggcctgttc
gccatggagcccatcgcggctgacgagatggtcattgagtacgtgggccagaacatccgc
caggtgatcgcggacatgcgggaaaagcgttacgaggacgagggcattggcagcagctac
atgttccgggtggaccacgacaccatcatcgacgccaccaagtgcggcaacttcgcgcgc
ttcatcaaccacagctgcaaccccaactgctatgccaaggtgatcacggtggagtcgcag
aagaagatcgtcatctactcaaagcagcacatcaacgtcaatgaggagatcacctacgac
tataagttccccatcgaggacgtcaagatcccctgcctgtgcggctccgagaactgccgg
gggaccctcaactag

DBGET integrated database retrieval system