KEGG   Felis catus (domestic cat): 101096459Help
Entry
101096459         CDS       T02385                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
fca  Felis catus (domestic cat)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101096459 (C1GALT1)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     101096459 (C1GALT1)
Glycosyltransferases [BR:fca01003]
 Glycan extension
  Type 3 chain
   101096459 (C1GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 368 aa AA seqDB search
MASKSWLNFLTFLCGSAIGFVLCSQLFSILLGEQGDTQPNILHNDPHARHSDDNGQNHLE
GQMNFNADSSQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTREGRDQLYWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKYNPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPENILKERSRAYKNEDPKVKX
ELLKEKHK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaaccttcctttgtggatctgcaattggattt
gttttatgttctcagttatttagtattttactgggagaacagggtgatacccagcctaat
attcttcataatgatcctcatgctaggcattcagatgataatggacagaatcatctagaa
ggacagatgaacttcaatgcagattctagccaacataaagatgagaacacagacatcgct
gaaaacctctatcagaaggttaaaattctttgctgggttatgacagggcctcaaaatcta
gagaaaaaggccaaacacgtcaaagctacatgggcccagcgttgtaataaagtgttgttt
atgagttcagaagaaaataaagacttccctgctgtgggactaaaaaccagagaaggcaga
gatcaactatactggaaaacaattaaagcttttcagtatgttcatgatcattatttagaa
gatgctgattggtttatgaaagcagatgatgatacatatgttatactagataatttgaga
tggcttctctcaaaatacaaccctgaagaacccatttactttggcagaagatttaagccc
tatgtaaagcagggctacatgagtggaggagcaggatatgtactgagcaaagaagccttg
aaaagatttgttgatgcatttaaaacagacaaatgtacacatagttcctccattgaagac
ttagcactggggagatgcatggaaattataaatgtagaagcgggagattccagagatacc
actggaaaagaaacttttcatccctttgtgccagaacaccacttaatcaaggggtatcta
cctagaaccttttggtactggaattacaactattatcctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaactatgtatgagttagaa
tacctcgtttatcatcttcgtccgtatggttatttatatagatatcaacctgccttacct
gagaatatactaaaagaaagaagtcgagcatacaaaaatgaagatccaaaagtaaaatga
gaactcttgaaagaaaaacataaatga

DBGET integrated database retrieval system