KEGG   Felis catus (domestic cat): 101096491Help
Entry
101096491         CDS       T02385                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4 (Dombrock blood group)
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101096491 (ART4)
Cellular antigens [BR:fca04090]
 Proteins
  101096491 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B4
AA seq 328 aa AA seqDB search
MKPQEQRSTFNTNKYHPLTNRCRRTLFPTTPTAPVLRIWLLPKQLPLLMLFSALQTPSGS
SEVAININFDLAPNSFDDQYQGCSQQVMEKLSQGDYFTKEIETHRNYYRVWSNAYLTWLN
QAKDLPKNINITHAVAISVYTSNNSIRTDFIRAMASATRTPRQYKHSFHFKYLHYYLTSA
IQLLRKEIVGKNNSLCYEVHHEMKGINLEAYRGATIRFGQFLSTSLRKEDTQKSENQTLF
TIFTCLGAPVEEVSVKKEVLVPPYELFKVVNMSYNPRGNWLQLQSAGNQSTYNCQLLKAS
SKKYNPAPMVIASLSFLTSVVISSKSRV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcaagagcaaagaagtacttttaacacaaacaaataccatccattgaccaac
agatgcaggaggactcttttcccaactactcctacagcccctgtgctgagaatctggctc
cttccaaagcagcttcctctcctgatgctgttctctgccttgcagacaccctctgggagt
tctgaggttgccattaacatcaactttgacttggcaccaaattcctttgatgatcagtac
caaggatgcagccagcaggtcatggagaagctaagtcaaggggattatttcacaaaagaa
atagaaacacatagaaattactacagggtctggagtaatgcctatttaacctggttgaac
caagcaaaagatctccccaagaacattaatattacacatgctgtggccatctcagtttat
acatcaaacaatagcattcgcacagacttcatcagagccatggccagtgctactaggact
ccacggcagtataaacattcattccatttcaaatacctacactactacctgacctcagca
atccagctgctaaggaaagagatagtcggaaagaataactcattgtgttatgaggtgcat
catgagatgaagggtatcaatttggaagcctacagaggtgccaccatccgatttggccaa
ttcctctccacctccctccgaaaagaagacacacagaagtctgaaaaccaaactctattt
accatattcacctgtctgggtgcacctgtagaagaagtttctgtcaagaaggaggtcctg
gtccctccctatgagttgttcaaagttgtaaatatgagctacaacccaagaggaaattgg
ttgcaattgcagtcagctgggaaccagagcacatataactgtcagctactaaaagcttcc
agcaaaaagtacaacccagctcccatggttattgcttctctctccttcttgaccagtgtc
gtcatctcttccaaaagtagagtataa

DBGET integrated database retrieval system