KEGG   Felis catus (domestic cat): 101096622Help
Entry
101096622         CDS       T02385                                 

Gene name
GEMIN7
Definition
gem (nuclear organelle) associated protein 7
Orthology
K13135  
gem associated protein 7
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101096622 (GEMIN7)
Spliceosome [BR:fca03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    101096622 (GEMIN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E2
AA seq 131 aa AA seqDB search
MQTPPAIPVPVLRLPRGPDGLSRGFAPDGRRAPPKPEAPGSPGSPAGRESRESREQRVRA
ALRERYLRSLLAMVGHQVNFTLHEGVHVTAHFGAADLDVANFYVLQLQTPIGVQAEALLR
CSDIISYTFKP
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgcagactccaccagccattcctgtgcctgtgctccggctcccccggggccctgatggc
ttgagccgaggctttgccccagacggacgcagggcccccccgaagccagaggctcctgga
agcccgggatctccagcaggtcgagagtctcgggaatcccgggaacagcgggtccgagcc
gcacttcgggaacgctacctccgcagcctgctggccatggtgggtcaccaggtgaacttc
acactgcacgagggtgtgcacgtgaccgcccacttcggagccgccgacctggacgtggcc
aacttctacgtgctgcagctgcagacgccgataggcgtgcaggccgaggcgctgctgcgg
tgtagtgacattatttcctacaccttcaagccgtga

DBGET integrated database retrieval system