KEGG   Felis catus (domestic cat): 101096637Help
Entry
101096637         CDS       T02385                                 

Gene name
KCNMB1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
fca  Felis catus (domestic cat)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:fca04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:fca04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A1
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVVCAVIAYYILGTTMLPLYQKSVWTQESTCHLIETNI
RDQEELEGKKVPQYPCLWVNVSAVGRWAVLYHTEDTRDQNQQCSYIPRSLENYQVARADV
EKVRTNFHEHRIFYCFSTTRENETTVLYRRLYGPQTLLFSLFWPTFLLTGGLLIIAMVKI
NQSLSILAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcggggagagactcgagccctttgcctgggt
gtggccatggtggtgtgtgctgtcattgcctactatatcctgggcacgaccatgctgccc
ctctaccagaaaagcgtgtggacccaggaatccacgtgccacctgattgagaccaacatc
agggaccaagaggagctggagggcaaaaaggtgccccagtacccatgcctgtgggtcaat
gtgtcagctgtgggccggtgggctgtgctgtaccacacggaggacactcgtgaccagaac
caacagtgctcctacatcccacgcagcctggaaaactaccaggtggcccgggccgatgtg
gagaaggtcagaacgaacttccacgagcatcggattttctactgcttctcaacgactcgg
gagaatgagaccactgtcctgtaccggcgcctctatggaccccagaccctgctcttctct
ctcttctggcccaccttcctgctgaccggtggcctcctcattatcgccatggtgaagatc
aaccagtccctttccatcctggcggctcagaagtag

DBGET integrated database retrieval system