KEGG   Felis catus (domestic cat): 101096744Help
Entry
101096744         CDS       T02385                                 

Gene name
RAC2
Definition
(RefSeq) ras-related C3 botulinum toxin substrate 2 isoform X1
  KO
K07860  Ras-related C3 botulinum toxin substrate 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04071  Sphingolipid signaling pathway
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04650  Natural killer cell mediated cytotoxicity
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05231  Choline metabolism in cancer
fca05416  Viral myocarditis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101096744 (RAC2)
   04015 Rap1 signaling pathway
    101096744 (RAC2)
   04010 MAPK signaling pathway
    101096744 (RAC2)
   04310 Wnt signaling pathway
    101096744 (RAC2)
   04370 VEGF signaling pathway
    101096744 (RAC2)
   04071 Sphingolipid signaling pathway
    101096744 (RAC2)
   04024 cAMP signaling pathway
    101096744 (RAC2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    101096744 (RAC2)
   04520 Adherens junction
    101096744 (RAC2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101096744 (RAC2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    101096744 (RAC2)
   04662 B cell receptor signaling pathway
    101096744 (RAC2)
   04664 Fc epsilon RI signaling pathway
    101096744 (RAC2)
   04666 Fc gamma R-mediated phagocytosis
    101096744 (RAC2)
   04670 Leukocyte transendothelial migration
    101096744 (RAC2)
   04062 Chemokine signaling pathway
    101096744 (RAC2)
  Development
   04360 Axon guidance
    101096744 (RAC2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101096744 (RAC2)
   05231 Choline metabolism in cancer
    101096744 (RAC2)
   05210 Colorectal cancer
    101096744 (RAC2)
   05212 Pancreatic cancer
    101096744 (RAC2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101096744 (RAC2)
   05416 Viral myocarditis
    101096744 (RAC2)
GTP-binding proteins [BR:fca04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101096744 (RAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf
Motif
Other DBs
NCBI-GeneID: 101096744
NCBI-ProteinID: XP_023113243
Ensembl: ENSFCAG00000025776
Position
B4
AA seq 234 aa AA seqDB search
MALPVPPPGPANSQTQGRGPESWPSLFSAHCGSGARFSPLSNLPTHLTLDPFYRAVGKTC
LLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVF
LICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIERLKEKKLAPIT
YPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRPQKRPCSIL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcgctacctgtgccccctcccggcccagccaactcgcagacccagggaagagggccc
gaatcgtggccatcactcttcagcgctcactgtgggtcaggcgcccggttctcccctctc
tccaatcttcccacccacctcacattagacccattttacagagccgtgggcaagacctgc
cttcttatcagctataccaccaatgccttccctggagagtacatccccaccgtgttcgac
aactattcagccaatgtgatggtggacagcaagcccgtgaacctggggctgtgggacacc
gcggggcaggaggactatgaccgcctccggccgctctcctacccacagacggacgtcttt
ctcatctgcttctcccttgtgagccctgcctcctacgagaatgtccgtgccaagtggttc
cctgaggtgcggcaccactgccccagcacgcccatcatcctggtgggcaccaagctggat
ctgcgggacgacaaggacaccatcgagaggctgaaggagaagaagctggcgcctattacc
tacccgcagggcctggcactggccaaggagatcgactcggtcaaatacctggagtgctca
gccctcacccagcgaggcctgaaaaccgtcttcgatgaggcgatccgggccgtcctgtgc
ccccagcccacgcggccacagaagcgcccctgcagcatcctttag

DBGET integrated database retrieval system