KEGG   Felis catus (domestic cat): 101096775Help
Entry
101096775         CDS       T02385                                 

Gene name
CES2
Definition
carboxylesterase 2
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
fca  Felis catus (domestic cat)
Pathway
Drug metabolism - other enzymes
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:fca00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E2
AA seq 540 aa AA seqDB search
MRLYLLRGCLNAVVCGLLLLVLGQGQDSASPIRTTHTGQVRGSLIHVKGTDVGVHTFLGI
PFAKPPLGPLRFAPPEPPESWSGVKDGTSHPAMCLQNITTTNEMFLKLLNATLPFTSMSE
DCLYLSIYTPAHAREGSNLPVLVWIHGGGFTVGMASMYDGSALAAFEDLVVVIIQYRLGV
LGFFSTGDKHATGNWGYLDQVAALRWVQQNIAYFGGDPGRVTISGESAGGTSVSSHVVSP
MSKGLFHGAIMESGVALLPSLIDSSSDVVSTMVANMSACGQIDSEALVDCLRGKSEEEIL
AINKPFRIVPGVVDGTFLPRHPHELLASADFQPVPSIIGVNNDEYGWLIPSGLDTSDTQK
DRETVKAVLRNMLAMLVLPPQSVDILMEEYLGDSADPQTLQVQFHEMMGDYIFVIPALQV
ASFQRVHAPVYFYEFQHRPSFFKDTKPPHVRADHVEVTEEEELLSRKIMKYWANFARNGN
PNGKGLPHWPVFDQEEQYLQLNLQPAVGRALKAHRLQFWTKTLPQKIQELKEAEENHTEL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtacctacttcgcgggtgtctgaacgccgtggtctgtggactcctgcttctc
gtcctgggccagggccaggactctgccagccccatccggaccacacacacggggcaggtg
cgggggagcctcatccacgtgaaaggcactgatgtgggggtccacaccttcctgggaatt
ccctttgctaaaccgcctctaggaccactgcgatttgcaccccctgagccccctgaatct
tggagtggtgtaaaagacgggacctcccacccagctatgtgtctgcagaacatcactacc
acaaatgagatgtttctgaagctgctgaatgcgaccttgcctttcacctccatgtccgaa
gactgcctgtacctcagcatttacacaccggcccacgccagggaaggctccaatctgccc
gtgttggtgtggatccacggtggtgggtttacggtcggcatggcttccatgtatgatggc
tctgcactggcggcctttgaggacctggtggtggtcattattcagtaccgcctgggtgta
ctgggcttcttcagcactggagacaagcatgcaaccggcaactggggctacctggatcaa
gtggctgcactacgctgggtccagcaaaatattgcctattttggaggagaccctggccgt
gtcaccatttctggcgagtctgcaggtggcacaagtgtgtcctcacatgtcgtgtccccc
atgtccaaaggactcttccatggtgccatcatggagagtggtgtggctctattgcccagc
ctcattgatagctcatctgatgtggtctccacgatggtggcaaacatgtctgcctgtggc
cagattgactcagaggcactggtggactgcctgaggggcaagagtgaagaggagattctg
gccattaataagcccttcaggatcgtccctggcgtggtggatgggaccttcctgcccagg
cacccccacgagctgctggcctctgccgactttcaacctgtccccagcatcattggtgtc
aacaacgatgagtacggttggctcatcccctcgggcttggacacctctgacacccagaag
gacagagagactgtgaaggctgttctgcggaatatgttggcaatgttggtgttgcctcct
cagtctgttgacatattgatggaggagtacttaggggacagtgcagacccacagaccctc
caggtccagttccatgagatgatgggggactatatcttcgtgatccctgcactccaagta
gccagttttcaacgtgtgcatgcccccgtctacttctatgagttccaacatcggcccagc
ttcttcaaggacaccaagccgccccacgtgagggcagaccatgttgaagtcactgaggag
gaagagctgttgagcaggaagataatgaagtactgggctaactttgctcgaaatgggaac
cccaacggcaaggggctgccccactggcctgtgttcgaccaggaagagcaatacttacag
ctgaacttgcagcctgcggtgggccgagccctgaaggcccacaggctccagttctggaca
aagaccctaccccagaagatacaggagctaaaggaggcggaggaaaatcacacagagctg
taa

DBGET integrated database retrieval system