KEGG   Felis catus (domestic cat): 101096839Help
Entry
101096839         CDS       T02385                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101096839 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D1
AA seq 320 aa AA seqDB search
MVPSTSGPRFPESPPKTMLVALLMALHALWQARAVPILPLGLAPDTFDDAYVGCAEEMEE
KAAPLLKEEMAGHALLRESWEAAREAWEHRRRGLTLPPGFKAQHGIAVMVYTNSSNTLYW
ELNQAVRTGGGSREFYMKYFPFKALHFYLTRALQLLQGSGGCSRGPGKVVFRGVGTLHFE
PKRLGDSVRLGQFASSSLDEAVARRFGNATFFSLRTCFGAPIQALSVFPEEREVLIPPHE
VFLVTRFSQEGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSVQTGGQPDSTSQGDFSL
LSWKTLFLAPRGFQISGVGP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtgccctcgacatctggacctcgctttcctgagtctccccccaaaacgatgctggtg
gctctgctgatggctctccatgccctctggcaggcccgggctgttcccatcctgcccctg
ggcctggctccagacacctttgatgatgcttatgtgggctgcgcagaggagatggaagaa
aaggcagcccctctgctgaaggaggagatggctggccacgccctgctgcgggagtcctgg
gaggcagcacgggaggcctgggagcacaggcgtcgagggctcaccctgccccctggcttc
aaagcccagcacggaatcgccgtcatggtctataccaactcatctaacactttatactgg
gagctgaaccaggctgtgcgaacaggcggtggctcccgggaattctacatgaagtacttc
cccttcaaggccctgcatttctacttgacccgggccctgcagctgctgcagggcagtggg
ggctgcagcaggggacctgggaaggtggtgttccgaggcgtgggcacccttcactttgaa
cccaagaggctgggggactctgtccgcttgggccagtttgcttccagctccctggatgag
gcagtggcccgcagatttggtaatgccaccttcttctctctaaggacttgctttggggcc
cctatccaggccttatctgtctttcctgaggagcgcgaggtgctgatccccccacatgaa
gtcttcttggtcaccaggttctcccaggaaggagcccagagcctggtgactctctggagc
tataatcagacctgcagccactttaactgtgcctatctgggtggggagaagaggcggggc
tgtgtatctgtacaaacaggaggacagccagactccacctcccagggggacttctctcta
ctctcctggaagaccctgttcttggcacctaggggcttccagatctcaggagttgggccc
tga

DBGET integrated database retrieval system