KEGG   Felis catus (domestic cat): 101096839Help
Entry
101096839         CDS       T02385                                 

Gene name
ART5
Definition
(RefSeq) ecto-ADP-ribosyltransferase 5 isoform X1
  KO
K19977  ADP-ribosyltransferase 5 [EC:2.4.2.31]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101096839 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ART ADPrib_exo_Tox
Motif
Other DBs
NCBI-GeneID: 101096839
NCBI-ProteinID: XP_006937069
Ensembl: ENSFCAG00000031739
UniProt: A0A2I2UC57
Position
D1
AA seq 320 aa AA seqDB search
MVPSTSGPRFPESPPKTMLVALLMALHALWQARAVPILPLGLAPDTFDDAYVGCAEEMEE
KAAPLLKEEMAGHALLRESWEAAREAWEHRRRGLTLPPGFKAQHGIAVMVYTNSSNTLYW
ELNQAVRTGGGSREFYMKYFPFKALHFYLTRALQLLQGSGGCSRGPGKVVFRGVGTLHFE
PKRLGDSVRLGQFASSSLDEAVARRFGNATFFSLRTCFGAPIQALSVFPEEREVLIPPHE
VFLVTRFSQEGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSVQTGGQPDSTSQGDFSL
LSWKTLFLAPRGFQISGVGP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggtgccctcgacatctggacctcgctttcctgagtctccccccaaaacgatgctggtg
gctctgctgatggctctccatgccctctggcaggcccgggctgttcccatcctgcccctg
ggcctggctccagacacctttgatgatgcttatgtgggctgcgcagaggagatggaagaa
aaggcagcccctctgctgaaggaggagatggctggccacgccctgctgcgggagtcctgg
gaggcagcacgggaggcctgggagcacaggcgtcgagggctcaccctgccccctggcttc
aaagcccagcacggaatcgccgtcatggtctataccaactcatctaacactttatactgg
gagctgaaccaggctgtgcgaacaggcggtggctcccgggaattctacatgaagtacttc
cccttcaaggccctgcatttctacttgacccgggccctgcagctgctgcagggcagtggg
ggctgcagcaggggacctgggaaggtggtgttccgaggcgtgggcacccttcactttgaa
cccaagaggctgggggactctgtccgcttgggccagtttgcttccagctccctggatgag
gcagtggcccgcagatttggtaatgccaccttcttctctctaaggacttgctttggggcc
cctatccaggccttatctgtctttcctgaggagcgcgaggtgctgatccccccacatgaa
gtcttcttggtcaccaggttctcccaggaaggagcccagagcctggtgactctctggagc
tataatcagacctgcagccactttaactgtgcctatctgggtggggagaagaggcggggc
tgtgtatctgtacaaacaggaggacagccagactccacctcccagggggacttctctcta
ctctcctggaagaccctgttcttggcacctaggggcttccagatctcaggagttgggccc
tga

DBGET integrated database retrieval system