KEGG   Felis catus (domestic cat): 101096916Help
Entry
101096916         CDS       T02385                                 

Gene name
CAPN1
Definition
calpain 1, (mu/I) large subunit
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
fca  Felis catus (domestic cat)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101096916 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101096916 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101096916 (CAPN1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     101096916 (CAPN1)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C2: calpain family
   101096916 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D1
AA seq 694 aa AA seqDB search
MAEEIITPVYCTGVSAQVQKQRAKELGLGRHENAIKYMGQDYEQLRAHCLQSGVLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDITSVLDMEAITFKKLVKGHAYSVTGAKQVNYQGQMVSLIRMRNPWGE
VEWTGAWSDGSSEWNNVDPYEREQLRIKMEDGEFWMSFRDFLREFSRLEICNLTPDALKS
RSIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDADDDYYGGRESGCS
FVLALMQKHRRRERRFGRDMETIGFAVYEVPPETRFRLPPGEYVVVPSTFEPNKEGDFVL
RFFSEKKAGTEELDDQIQANLPDEQVLSEEEIDENFKALFRQLAGEDMEISVKELRTILN
RIISKHKDLRTKGFSLESCRSMVNLMDVSFAFVPPQPLAHLSGLCPPPAAAPHPGVGQKG
WAIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELIITRYSEPDLAVDFDNFVCCLV
RLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggaaatcatcaccccggtgtactgcacgggggtgtctgcacaagtgcagaag
cagcgggccaaggagctgggccttggccgccacgaaaatgccatcaagtacatgggccag
gattatgagcagctgcgggctcactgtctgcagagtggggtcctctttcgtgacgaggcc
ttccccccggtgccccagagcctgggctacaaggacctgggccccaactcctccaaaacc
tatggcatcaagtggaagcgtcccacggagctgctctcaaacccccagttcattgtggat
ggagccacacgcacagacatctgccagggagcactgggggactgttggctcctggctgcc
attgcctccctcacccttaatgacacgcttctgcatcgagtggttccacatggccaaagc
ttccagaatggctatgccggcatctttcatttccagctgtggcagtttggggaatgggta
gatgtggtcgtggatgacctactgcccatcaaggacgggaagctggtgtttgtgcactcc
gcccaaggcaatgagttctggagcgccctgctcgagaaggcctatgccaaggtgaatggc
agctacgaggccctctccgggggcagcacttcggagggctttgaggacttcacaggcgga
gtcaccgagtggtatgagctgcgcaaggcacccagcgacctctaccagatcatcctcaag
gcgctcgagcgaggttccctcctgggctgctccatcgacatcaccagtgtcctggacatg
gaggccatcaccttcaagaagctggtgaagggccacgcctactctgtgacgggggccaag
caggtgaactaccagggccagatggtgagcctgatccggatgcggaatccctggggcgag
gtggagtggacgggagcctggagcgacggctcctcggagtggaacaacgtggacccttac
gagcgggagcagctccggatcaagatggaggatggagagttctggatgtccttccgagac
ttcttgcgtgagttctcccgcctggagatctgcaacctgacgcccgacgcgctcaagagc
cggtccatccgcaaatggaacaccacgctctacgagggcacctggcggcgggggagcacc
gcggggggctgccggaactacccagccaccttctgggtcaatccccagttcaagatccga
ctggaggagacggacgacgcggacgacgactactacgggggtcgcgaatcaggctgcagc
ttcgtgctagccctcatgcagaagcaccgccgtcgcgagcgccgctttggccgcgacatg
gagaccatcggcttcgcggtctacgaggttcctccggagacccgcttccgcttgccgccc
ggggagtacgtggtggtgccctccaccttcgagcccaacaaagagggcgacttcgtgcta
cgcttcttctcggagaagaaggccgggaccgaggagctggacgaccagatccaggccaat
ctccctgatgagcaagtgctctcagaagaggagattgatgagaacttcaaggccctcttc
aggcagctggcaggggaggacatggagatcagcgtcaaggaactgcggaccatcctcaac
aggatcatcagcaaacacaaggacctgcggacaaagggcttcagcctggagtcgtgccgc
agcatggtgaacctcatggacgtatcttttgctttcgttccaccccagcccctggcccac
ctttcgggtctttgccctccacccgcagcagccccccaccctggggtgggccagaagggc
tgggccatcttccggaagtttgacttggacaagtcgggcagcatgagtgcctacgagatg
cggatggccatcgagtctgcgggcttcaagctcaacaagaagctgtatgaactcatcatc
acccgctactcggagcccgacctggccgtggactttgacaacttcgtgtgctgcctggtg
cggctggagaccatgttccggtttttcaaaactctggacacagatctggacggggtggtg
acctttgacttgtttaagtggttacagctgaccatgtttgcatga

DBGET integrated database retrieval system