KEGG   Felis catus (domestic cat): 101096956Help
Entry
101096956         CDS       T02385                                 

Definition
ubiquitin carboxyl-terminal hydrolase 51-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101096956
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101096956
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101096956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 700 aa AA seqDB search
MVGGVLRALMARRRHDAGQIIHRNPCLIPSTVAAPFQTFLLRPGGERMAQVRETSLSSSS
LVRXSSGGGGGASPEEEVLPSTPPRCYSSSSPLCPRRKPRPRPQPRVRARALPGPSAPPQ
PPAHPPPQLLTRPQSWRRSRRRSRPGSRPQKLQSCSPDLGGSADRGGLGDWLLEVQFDQG
PTGCSHVESFKVAKNWRKNLRLIYQRFVWSGTPETRKRKAKSCFCHVCSTHMNRLHSCLS
CVFFGCFTEKHIHKHAETKQHNLAVDLYHGVIYCFMCKDYVYDKDIEQIAKETKEKILKL
LTSISTDVSQQQCMTSGVEEKHSTCESKEQEPKLVKPKKKRRKKSVCTVGLRGLINLGNT
CFMNCIVQALTHIPLLKDFFLSDKHKCVMTSPSLCLVCEMSSLFHAMYSGSRTPHIPYKL
LHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSVGQEANNPNCCNCIIDQIFTGG
LQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFSSQSPEGADSTVSRDDHIPGIPSLTD
CLQWFTRPEYLGSSAKIKCSSCQSYQESTKQLTMKKLPIVACFHLKRFEHVGKQRRKINT
FISFPLELDMTPFLASTKDSRMKEDQPPTDCTPNENKYSLFAVINHHGTLESGHYTSFIR
QQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKE
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggtgggaggggtcctgagggcgctaatggcgcgccgccgccatgatgctggccagatc
attcacagaaatccctgtctcattccatctacagtcgcagctccattccagacctttctt
ctcaggccgggcggtgagcggatggcccaagttcgggaaacttccttgtcttccagctct
ttggtccgctagagctcgggcggtgggggaggagcctcgcccgaggaggaggtgctccct
tcaaccccacctcgctgttacagcagctcttcgcccctttgcccgcgccgcaagccccgc
cctcggccccagccccgggtccgggcccgagccctgccggggccctcggccccaccccag
cctccagcccatcctccccctcagcttctgacccggccccagtcctggcgcagatcgcgg
cgtagatcccggcctgggtctaggccccagaagctgcaaagctgttctcctgacctaggt
ggctctgcggatcgaggtggcctaggggactggttgctggaggtgcagtttgatcagggt
cctacaggctgctctcatgtggagagctttaaagtggctaagaactggaggaagaacctg
cggttgatctaccagcgtttcgtttggagtgggaccccagaaactaggaaacgtaaggca
aagtcgtgcttctgtcatgtatgtagtacccatatgaacagactccactcttgtctctcc
tgtgtcttttttggctgctttactgagaaacatattcacaaacatgcagaaacaaaacag
cataatttagctgtagacctctatcatggggttatatattgctttatgtgtaaggattat
gtatatgacaaagacatagaacagattgccaaagaaacaaaagagaaaattctgaaatta
ctaacttccatctcaacagatgtttctcaacaacagtgtatgacatcaggtgttgaagag
aaacattcaacctgtgagtcaaaggaacaggagccaaaattggtgaaacccaagaaaaag
aggaggaaaaagtcagtctgtactgtaggcctgagagggctaatcaatcttgggaacacg
tgctttatgaattgtattgtccaggcacttacccatattcctttattgaaagatttcttt
ctctctgacaagcataaatgtgtaatgacaagccccagcttgtgtcttgtctgtgaaatg
tcttctctttttcatgcaatgtactctgggagccgaactcctcacattccttataagtta
ttgcatctaatatggattcatgcagaacacttagcaggatataggcagcaggatgcccat
gagttccttatcgcaatattagatgtgctgcatagacacagcaaagatgatagtgttggg
caggaggccaataaccccaattgctgtaactgcatcatagaccaaatctttacaggtggc
ttgcagtcagatgtcacatgtcaagcttgccatagtgtctctaccacaatagacccatgc
tgggacatcagtttggacttgcctggctcttgtgccacattcagttcccagagtccagag
ggagctgacagcacagtgagtagggatgaccacataccaggtattccctcactcacagat
tgcctacagtggtttacaaggccagagtacctaggaagcagtgccaaaatcaaatgcagt
agttgccaaagctatcaggaatctaccaaacaactcacgatgaagaaattacctatcgtg
gcctgttttcatctcaagcgatttgaacatgtaggtaaacagaggcgaaagattaatact
tttatctcctttcccttggagctggatatgactccatttttggcctccactaaggacagc
agaatgaaggaagaccagccaccaacagattgtacacccaatgagaataagtattccttg
tttgcagtgattaatcaccatggaactttggaaagtggacactataccagctttatccgg
caacaaaaggaccaatggtttagctgtgatgatgccatcatcaccaaggctaccattgag
gacttactctacagtgaagggtatttactgttctatcacaaacagggtctagagaaagaa
tag

DBGET integrated database retrieval system